Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428T2Q4

Protein Details
Accession A0A428T2Q4    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
199-220ALGKSMREAKKKRDERGARAHLBasic
NLS Segment(s)
PositionSequence
144-152KSRREGKNR
197-218KEALGKSMREAKKKRDERGARA
Subcellular Location(s) cyto 9.5, nucl 7, cyto_mito 7, pero 6, mito 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR022284  GPAT/DHAPAT  
IPR045520  GPAT/DHAPAT_C  
Gene Ontology GO:0008374  F:O-acyltransferase activity  
GO:0044255  P:cellular lipid metabolic process  
Pfam View protein in Pfam  
PF19277  GPAT_C  
Amino Acid Sequences MVGLTDDERKAGRENYDFYCFLIWPFVEATWLAAVSLMGLTPPLGQNGEIWIEQGKAYNSAQLLGKTLFHQGDLSYFEAVNKETLKNSYFRFEQDELLLVVKSKDPKIPPRIQLGASWRPSRDAKTGALRADGKLWDFTEKIAKSRREGKNRRNGATVSSRVLRLTDELGRKLWEETVEAERSGKGKVPSRLSNEEKEALGKSMREAKKKRDERGARAHL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.37
3 0.42
4 0.4
5 0.37
6 0.35
7 0.29
8 0.24
9 0.23
10 0.18
11 0.14
12 0.15
13 0.14
14 0.13
15 0.13
16 0.13
17 0.1
18 0.1
19 0.08
20 0.07
21 0.07
22 0.06
23 0.06
24 0.04
25 0.04
26 0.04
27 0.04
28 0.05
29 0.06
30 0.07
31 0.08
32 0.08
33 0.08
34 0.11
35 0.13
36 0.11
37 0.11
38 0.11
39 0.11
40 0.11
41 0.13
42 0.12
43 0.12
44 0.12
45 0.14
46 0.14
47 0.15
48 0.16
49 0.14
50 0.16
51 0.14
52 0.14
53 0.13
54 0.17
55 0.15
56 0.14
57 0.14
58 0.11
59 0.12
60 0.14
61 0.14
62 0.11
63 0.11
64 0.11
65 0.11
66 0.12
67 0.12
68 0.11
69 0.1
70 0.11
71 0.13
72 0.14
73 0.16
74 0.17
75 0.19
76 0.18
77 0.19
78 0.24
79 0.23
80 0.23
81 0.2
82 0.2
83 0.16
84 0.16
85 0.15
86 0.09
87 0.08
88 0.09
89 0.1
90 0.11
91 0.14
92 0.16
93 0.24
94 0.33
95 0.38
96 0.4
97 0.43
98 0.45
99 0.42
100 0.41
101 0.4
102 0.39
103 0.37
104 0.35
105 0.3
106 0.31
107 0.32
108 0.32
109 0.28
110 0.24
111 0.23
112 0.28
113 0.31
114 0.29
115 0.31
116 0.29
117 0.26
118 0.26
119 0.23
120 0.17
121 0.15
122 0.15
123 0.13
124 0.13
125 0.13
126 0.19
127 0.18
128 0.22
129 0.28
130 0.3
131 0.32
132 0.42
133 0.51
134 0.54
135 0.63
136 0.69
137 0.72
138 0.78
139 0.76
140 0.7
141 0.62
142 0.56
143 0.54
144 0.47
145 0.4
146 0.34
147 0.32
148 0.28
149 0.28
150 0.23
151 0.17
152 0.17
153 0.2
154 0.22
155 0.23
156 0.24
157 0.24
158 0.24
159 0.24
160 0.22
161 0.17
162 0.14
163 0.16
164 0.2
165 0.21
166 0.2
167 0.2
168 0.2
169 0.2
170 0.19
171 0.21
172 0.21
173 0.27
174 0.34
175 0.41
176 0.46
177 0.53
178 0.61
179 0.62
180 0.62
181 0.6
182 0.55
183 0.48
184 0.44
185 0.37
186 0.31
187 0.28
188 0.23
189 0.22
190 0.3
191 0.35
192 0.43
193 0.48
194 0.55
195 0.64
196 0.72
197 0.76
198 0.77
199 0.8
200 0.8