Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428SJA1

Protein Details
Accession A0A428SJA1    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
96-126TIHKRSRSPSPLPSRKRRHYREQPMAIRPRDBasic
NLS Segment(s)
PositionSequence
99-115KRSRSPSPLPSRKRRHY
Subcellular Location(s) nucl 16, cyto_nucl 12.5, cyto 7, mito 2, pero 2
Family & Domain DBs
Amino Acid Sequences MAEHREVLNRSGNSGLDRLSITRETLSMESFTHPPQLNVLRDEAFKVVGKIRDAWATAVSKPNKRALSDLPILMAVYDGLLCDLENRQRLAAEDATIHKRSRSPSPLPSRKRRHYREQPMAIRPRDGVFRGPSSDAARSPGRATVVHPKEGELYLVYRKRSRRWLAALLLPRKDLSVVAHLSSIFNTRHLEWRRGCEDGGPFSFMQKFPIAFFAGPRFPDRSATEWVAAGELQAFDESCFTPSSVPHYRVVRAFLERRTVYRALYDRIGEAVPDERTDSRGEQIHISTSGAVAQPQPTISQRAVPVNSSEASRVPVLAETYRLPQINNGVNENSLPSLSEIAICVPGSRFGLFEWPEDVPQRILDLLAKKSKAWIAQLSGGSSDKSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.25
3 0.19
4 0.2
5 0.19
6 0.21
7 0.21
8 0.2
9 0.19
10 0.19
11 0.2
12 0.2
13 0.21
14 0.18
15 0.18
16 0.2
17 0.21
18 0.22
19 0.26
20 0.25
21 0.24
22 0.29
23 0.35
24 0.35
25 0.35
26 0.37
27 0.32
28 0.32
29 0.34
30 0.28
31 0.23
32 0.2
33 0.21
34 0.23
35 0.24
36 0.25
37 0.26
38 0.27
39 0.28
40 0.28
41 0.27
42 0.26
43 0.25
44 0.25
45 0.32
46 0.36
47 0.38
48 0.41
49 0.47
50 0.46
51 0.45
52 0.47
53 0.44
54 0.46
55 0.44
56 0.41
57 0.34
58 0.3
59 0.29
60 0.24
61 0.18
62 0.09
63 0.05
64 0.05
65 0.04
66 0.04
67 0.04
68 0.04
69 0.05
70 0.09
71 0.13
72 0.17
73 0.18
74 0.18
75 0.18
76 0.2
77 0.23
78 0.21
79 0.18
80 0.17
81 0.21
82 0.26
83 0.28
84 0.27
85 0.25
86 0.27
87 0.29
88 0.36
89 0.39
90 0.4
91 0.47
92 0.58
93 0.67
94 0.72
95 0.8
96 0.81
97 0.83
98 0.88
99 0.86
100 0.86
101 0.87
102 0.88
103 0.88
104 0.88
105 0.85
106 0.84
107 0.85
108 0.75
109 0.65
110 0.56
111 0.46
112 0.4
113 0.34
114 0.29
115 0.23
116 0.24
117 0.24
118 0.24
119 0.25
120 0.24
121 0.25
122 0.21
123 0.22
124 0.21
125 0.19
126 0.19
127 0.19
128 0.17
129 0.16
130 0.18
131 0.25
132 0.27
133 0.3
134 0.29
135 0.28
136 0.28
137 0.27
138 0.25
139 0.15
140 0.14
141 0.17
142 0.2
143 0.22
144 0.25
145 0.28
146 0.33
147 0.42
148 0.45
149 0.45
150 0.48
151 0.52
152 0.5
153 0.52
154 0.55
155 0.5
156 0.46
157 0.39
158 0.33
159 0.27
160 0.24
161 0.19
162 0.12
163 0.13
164 0.12
165 0.12
166 0.13
167 0.13
168 0.13
169 0.13
170 0.14
171 0.1
172 0.1
173 0.11
174 0.12
175 0.2
176 0.23
177 0.29
178 0.27
179 0.33
180 0.33
181 0.33
182 0.32
183 0.27
184 0.26
185 0.22
186 0.21
187 0.18
188 0.16
189 0.16
190 0.18
191 0.15
192 0.16
193 0.14
194 0.13
195 0.11
196 0.14
197 0.14
198 0.12
199 0.13
200 0.14
201 0.14
202 0.15
203 0.17
204 0.17
205 0.16
206 0.2
207 0.21
208 0.21
209 0.24
210 0.25
211 0.23
212 0.21
213 0.21
214 0.17
215 0.15
216 0.11
217 0.07
218 0.05
219 0.05
220 0.05
221 0.05
222 0.04
223 0.06
224 0.06
225 0.07
226 0.07
227 0.07
228 0.08
229 0.09
230 0.16
231 0.2
232 0.22
233 0.26
234 0.28
235 0.3
236 0.31
237 0.34
238 0.3
239 0.3
240 0.32
241 0.3
242 0.35
243 0.33
244 0.33
245 0.36
246 0.34
247 0.29
248 0.31
249 0.32
250 0.27
251 0.28
252 0.27
253 0.21
254 0.22
255 0.21
256 0.15
257 0.13
258 0.13
259 0.11
260 0.11
261 0.13
262 0.12
263 0.13
264 0.16
265 0.16
266 0.17
267 0.2
268 0.21
269 0.21
270 0.21
271 0.22
272 0.2
273 0.2
274 0.16
275 0.12
276 0.13
277 0.11
278 0.11
279 0.1
280 0.1
281 0.11
282 0.11
283 0.13
284 0.13
285 0.17
286 0.16
287 0.19
288 0.21
289 0.27
290 0.28
291 0.27
292 0.27
293 0.26
294 0.26
295 0.23
296 0.21
297 0.16
298 0.17
299 0.16
300 0.14
301 0.12
302 0.13
303 0.14
304 0.14
305 0.15
306 0.14
307 0.18
308 0.22
309 0.22
310 0.2
311 0.21
312 0.27
313 0.31
314 0.32
315 0.32
316 0.29
317 0.29
318 0.29
319 0.28
320 0.21
321 0.14
322 0.13
323 0.1
324 0.11
325 0.11
326 0.11
327 0.1
328 0.1
329 0.12
330 0.11
331 0.12
332 0.11
333 0.13
334 0.14
335 0.14
336 0.13
337 0.12
338 0.2
339 0.21
340 0.21
341 0.22
342 0.22
343 0.24
344 0.26
345 0.28
346 0.21
347 0.2
348 0.2
349 0.17
350 0.16
351 0.19
352 0.22
353 0.27
354 0.33
355 0.34
356 0.33
357 0.38
358 0.41
359 0.4
360 0.4
361 0.39
362 0.37
363 0.42
364 0.44
365 0.41
366 0.39
367 0.36