Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A428U1E7

Protein Details
Accession A0A428U1E7    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
57-77GPQLEAEERKRKKQKKEEEEDAcidic
NLS Segment(s)
PositionSequence
65-72RKRKKQKK
Subcellular Location(s) nucl 14.5, mito 10.5, cyto_nucl 8.833, cyto_mito 6.833
Family & Domain DBs
Amino Acid Sequences MCVIFWREQVCRRCMKTLHKTETGRNKCKKALEGRACFCDEYSNCDWVEGPDCPTCGPQLEAEERKRKKQKKEEEED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.61
3 0.64
4 0.68
5 0.69
6 0.69
7 0.68
8 0.7
9 0.75
10 0.74
11 0.73
12 0.7
13 0.68
14 0.63
15 0.64
16 0.63
17 0.6
18 0.61
19 0.61
20 0.61
21 0.59
22 0.57
23 0.55
24 0.48
25 0.39
26 0.33
27 0.24
28 0.24
29 0.23
30 0.22
31 0.21
32 0.21
33 0.21
34 0.17
35 0.2
36 0.13
37 0.14
38 0.14
39 0.14
40 0.15
41 0.15
42 0.15
43 0.13
44 0.14
45 0.12
46 0.16
47 0.24
48 0.3
49 0.38
50 0.47
51 0.5
52 0.59
53 0.68
54 0.72
55 0.75
56 0.79
57 0.83