Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LHI1

Protein Details
Accession E2LHI1   
Localization Confidence Low
Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
137-157MNKAVREQRRHGKPVKEEPAEBasic
NLS Segment(s)
Subcellular Location(s) nucl 7, cyto 6.5, mito_nucl 6.5, mito 6, cyto_pero 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR040976  Pkinase_fungal  
KEGG mpr:MPER_05960  -  
Pfam View protein in Pfam  
PF17667  Pkinase_fungal  
Amino Acid Sequences MYNTVTKKCILNDYDLATLMDPGMELPNRKGYEQTGTRPFMALDLLKADGVTQCRYRYDLESFCWVLVWVGACVQGGQETVPSTYEAMALASHTQVFEKKSTLLLDFASYTTTEDYHDLENIIVDWMMWWCSFRGTMNKAVREQRRHGKPVKEEPAEW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.34
3 0.32
4 0.24
5 0.22
6 0.15
7 0.11
8 0.07
9 0.06
10 0.09
11 0.1
12 0.12
13 0.14
14 0.22
15 0.24
16 0.24
17 0.25
18 0.24
19 0.31
20 0.35
21 0.39
22 0.39
23 0.4
24 0.4
25 0.39
26 0.37
27 0.28
28 0.25
29 0.18
30 0.11
31 0.1
32 0.1
33 0.1
34 0.09
35 0.09
36 0.09
37 0.11
38 0.14
39 0.15
40 0.15
41 0.17
42 0.19
43 0.2
44 0.21
45 0.24
46 0.24
47 0.23
48 0.27
49 0.26
50 0.24
51 0.23
52 0.19
53 0.14
54 0.12
55 0.1
56 0.05
57 0.05
58 0.05
59 0.05
60 0.05
61 0.05
62 0.04
63 0.04
64 0.04
65 0.04
66 0.04
67 0.05
68 0.05
69 0.06
70 0.06
71 0.06
72 0.06
73 0.05
74 0.05
75 0.05
76 0.05
77 0.05
78 0.05
79 0.05
80 0.05
81 0.05
82 0.07
83 0.09
84 0.1
85 0.11
86 0.11
87 0.13
88 0.14
89 0.15
90 0.14
91 0.13
92 0.13
93 0.12
94 0.11
95 0.1
96 0.09
97 0.09
98 0.09
99 0.09
100 0.09
101 0.09
102 0.1
103 0.11
104 0.11
105 0.1
106 0.1
107 0.1
108 0.09
109 0.08
110 0.06
111 0.05
112 0.05
113 0.05
114 0.07
115 0.07
116 0.07
117 0.07
118 0.08
119 0.1
120 0.12
121 0.2
122 0.22
123 0.32
124 0.39
125 0.44
126 0.48
127 0.57
128 0.63
129 0.63
130 0.67
131 0.68
132 0.7
133 0.74
134 0.76
135 0.76
136 0.77
137 0.8
138 0.82