Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428RY41

Protein Details
Accession A0A428RY41    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
131-159KILANHIEVKRRKRRRGKLSTFPRPPESLHydrophilic
NLS Segment(s)
PositionSequence
140-148KRRKRRRGK
Subcellular Location(s) nucl 10cyto 10cyto_nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR022198  DUF3723  
Pfam View protein in Pfam  
PF12520  DUF3723  
Amino Acid Sequences MKDMASLPGLWEDIKLGNWAKHLAAHVDELIVVYWRDHMRKIWDGIFEGLEDQERYLDPYTARFVQFKSPARSQTDRRAIRDEMAKGSLFPNISDQAQRDKLLDNIVKIKAVIPSILTFHENMRYLTMGAKILANHIEVKRRKRRRGKLSTFPRPPESLVENLGRDWS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.15
3 0.16
4 0.17
5 0.19
6 0.2
7 0.19
8 0.2
9 0.21
10 0.2
11 0.18
12 0.18
13 0.16
14 0.15
15 0.14
16 0.12
17 0.11
18 0.09
19 0.08
20 0.06
21 0.11
22 0.13
23 0.15
24 0.16
25 0.19
26 0.24
27 0.29
28 0.32
29 0.31
30 0.3
31 0.3
32 0.3
33 0.27
34 0.21
35 0.17
36 0.14
37 0.12
38 0.1
39 0.08
40 0.07
41 0.07
42 0.09
43 0.1
44 0.11
45 0.1
46 0.12
47 0.16
48 0.17
49 0.19
50 0.17
51 0.18
52 0.22
53 0.29
54 0.34
55 0.36
56 0.37
57 0.4
58 0.45
59 0.49
60 0.47
61 0.5
62 0.54
63 0.52
64 0.51
65 0.51
66 0.45
67 0.43
68 0.44
69 0.35
70 0.27
71 0.25
72 0.21
73 0.17
74 0.17
75 0.16
76 0.12
77 0.1
78 0.11
79 0.1
80 0.11
81 0.12
82 0.13
83 0.16
84 0.18
85 0.19
86 0.17
87 0.17
88 0.17
89 0.22
90 0.22
91 0.19
92 0.21
93 0.21
94 0.2
95 0.19
96 0.2
97 0.15
98 0.15
99 0.13
100 0.1
101 0.1
102 0.11
103 0.12
104 0.12
105 0.11
106 0.12
107 0.16
108 0.16
109 0.16
110 0.16
111 0.15
112 0.15
113 0.16
114 0.16
115 0.13
116 0.12
117 0.13
118 0.12
119 0.13
120 0.14
121 0.13
122 0.17
123 0.18
124 0.27
125 0.32
126 0.42
127 0.51
128 0.61
129 0.7
130 0.76
131 0.85
132 0.87
133 0.92
134 0.92
135 0.92
136 0.93
137 0.93
138 0.91
139 0.87
140 0.81
141 0.72
142 0.64
143 0.59
144 0.52
145 0.45
146 0.4
147 0.38
148 0.34