Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LGL3

Protein Details
Accession E2LGL3    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
3-29EARSTFRKTRRLGKKIHYSKPLKDKLKBasic
NLS Segment(s)
PositionSequence
10-17KTRRLGKK
78-94RRGVRVPKVSKDRKALK
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, cyto 5.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012337  RNaseH-like_sf  
KEGG mpr:MPER_05597  -  
Amino Acid Sequences MAEARSTFRKTRRLGKKIHYSKPLKDKLKDICEHLHITYKTLKKLIAVRWNSLHTMWASFDHLEAALDELCDPPVERRRGVRVPKVSKDRKALKAWKLGEEEWALVKEMVPLLENFVFATQHMQTNKHPLLFQVIKHMDTLNEILEEWARDTTKSTVTRLGAAKGLAVLDKYYSRTDDSIMY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.76
3 0.81
4 0.82
5 0.85
6 0.85
7 0.8
8 0.81
9 0.83
10 0.83
11 0.8
12 0.73
13 0.72
14 0.71
15 0.74
16 0.68
17 0.62
18 0.57
19 0.53
20 0.52
21 0.46
22 0.45
23 0.36
24 0.35
25 0.38
26 0.37
27 0.36
28 0.35
29 0.34
30 0.29
31 0.36
32 0.41
33 0.42
34 0.41
35 0.42
36 0.44
37 0.45
38 0.43
39 0.36
40 0.31
41 0.21
42 0.19
43 0.16
44 0.14
45 0.14
46 0.13
47 0.12
48 0.11
49 0.1
50 0.09
51 0.08
52 0.08
53 0.06
54 0.06
55 0.06
56 0.05
57 0.06
58 0.06
59 0.06
60 0.09
61 0.17
62 0.19
63 0.2
64 0.23
65 0.29
66 0.37
67 0.43
68 0.47
69 0.49
70 0.53
71 0.59
72 0.67
73 0.66
74 0.64
75 0.66
76 0.65
77 0.62
78 0.63
79 0.64
80 0.59
81 0.62
82 0.58
83 0.54
84 0.49
85 0.43
86 0.37
87 0.3
88 0.25
89 0.18
90 0.17
91 0.13
92 0.1
93 0.1
94 0.08
95 0.07
96 0.07
97 0.06
98 0.06
99 0.08
100 0.09
101 0.09
102 0.08
103 0.08
104 0.08
105 0.07
106 0.1
107 0.08
108 0.12
109 0.14
110 0.17
111 0.18
112 0.27
113 0.29
114 0.27
115 0.26
116 0.23
117 0.3
118 0.3
119 0.29
120 0.3
121 0.3
122 0.29
123 0.3
124 0.3
125 0.21
126 0.21
127 0.21
128 0.12
129 0.11
130 0.1
131 0.1
132 0.11
133 0.11
134 0.1
135 0.11
136 0.11
137 0.11
138 0.14
139 0.16
140 0.23
141 0.25
142 0.26
143 0.29
144 0.3
145 0.36
146 0.35
147 0.34
148 0.29
149 0.26
150 0.24
151 0.19
152 0.18
153 0.14
154 0.12
155 0.11
156 0.11
157 0.13
158 0.15
159 0.17
160 0.19
161 0.21
162 0.21