Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A428TQS4

Protein Details
Accession A0A428TQS4    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
89-111ILSKKFKEKIKARNPRGSKKPDIBasic
NLS Segment(s)
PositionSequence
91-108SKKFKEKIKARNPRGSKK
Subcellular Location(s) cyto 9.5, cyto_nucl 9.5, nucl 8.5, mito 8
Family & Domain DBs
Amino Acid Sequences MFCSASDQGSHNTEASFPGNWNLCLRVGGATFTGEKLMWVEDSVDFWFPGHSAPLRSSDAKSTVSESGSSAFKAMSTGNERKFPRTEEILSKKFKEKIKARNPRGSKKPDIASLEWDENKKALEDLFTYIKGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.17
4 0.14
5 0.18
6 0.19
7 0.2
8 0.21
9 0.21
10 0.19
11 0.18
12 0.18
13 0.15
14 0.13
15 0.13
16 0.12
17 0.12
18 0.12
19 0.11
20 0.11
21 0.09
22 0.09
23 0.08
24 0.08
25 0.07
26 0.07
27 0.08
28 0.07
29 0.09
30 0.1
31 0.1
32 0.09
33 0.09
34 0.08
35 0.07
36 0.07
37 0.08
38 0.08
39 0.09
40 0.1
41 0.13
42 0.16
43 0.18
44 0.18
45 0.19
46 0.2
47 0.2
48 0.2
49 0.18
50 0.17
51 0.16
52 0.15
53 0.13
54 0.13
55 0.11
56 0.11
57 0.09
58 0.07
59 0.07
60 0.07
61 0.07
62 0.08
63 0.14
64 0.2
65 0.22
66 0.29
67 0.31
68 0.34
69 0.35
70 0.35
71 0.34
72 0.33
73 0.34
74 0.37
75 0.44
76 0.47
77 0.49
78 0.48
79 0.49
80 0.51
81 0.52
82 0.52
83 0.53
84 0.57
85 0.64
86 0.73
87 0.75
88 0.79
89 0.83
90 0.83
91 0.85
92 0.82
93 0.78
94 0.75
95 0.71
96 0.68
97 0.66
98 0.57
99 0.54
100 0.51
101 0.5
102 0.46
103 0.43
104 0.37
105 0.32
106 0.31
107 0.25
108 0.21
109 0.15
110 0.14
111 0.15
112 0.18
113 0.21