Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428RNW2

Protein Details
Accession A0A428RNW2    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
6-35QKRASGKASLRPNRIRRKHSTKQEDYKWESHydrophilic
NLS Segment(s)
PositionSequence
7-24KRASGKASLRPNRIRRKH
Subcellular Location(s) nucl 20.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016197  Chromo-like_dom_sf  
IPR008251  Chromo_shadow_dom  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF01393  Chromo_shadow  
Amino Acid Sequences MKTRSQKRASGKASLRPNRIRRKHSTKQEDYKWESLEIDRVELEELTGSFIVVVKWPNGDVSQHDKVEIYNKSPRKMLKFYERHIQFVDREEAEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.73
3 0.72
4 0.78
5 0.79
6 0.82
7 0.81
8 0.8
9 0.82
10 0.83
11 0.84
12 0.85
13 0.84
14 0.84
15 0.85
16 0.83
17 0.79
18 0.73
19 0.63
20 0.53
21 0.45
22 0.36
23 0.32
24 0.23
25 0.18
26 0.14
27 0.13
28 0.12
29 0.11
30 0.1
31 0.05
32 0.05
33 0.05
34 0.05
35 0.05
36 0.04
37 0.05
38 0.05
39 0.05
40 0.06
41 0.06
42 0.06
43 0.06
44 0.07
45 0.08
46 0.09
47 0.11
48 0.18
49 0.22
50 0.22
51 0.23
52 0.22
53 0.22
54 0.28
55 0.26
56 0.23
57 0.28
58 0.32
59 0.34
60 0.39
61 0.44
62 0.44
63 0.48
64 0.51
65 0.54
66 0.57
67 0.59
68 0.65
69 0.62
70 0.59
71 0.56
72 0.52
73 0.43
74 0.41
75 0.43