Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428RNT5

Protein Details
Accession A0A428RNT5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
2-23VTDGMAKQRREKRKFKSESDIFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 8, cyto_mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR016197  Chromo-like_dom_sf  
IPR000953  Chromo/chromo_shadow_dom  
IPR023780  Chromo_domain  
IPR023779  Chromodomain_CS  
Gene Ontology GO:1901363  F:heterocyclic compound binding  
GO:0097159  F:organic cyclic compound binding  
GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF00385  Chromo  
PROSITE View protein in PROSITE  
PS00598  CHROMO_1  
PS50013  CHROMO_2  
CDD cd00024  CD_CSD  
Amino Acid Sequences MVTDGMAKQRREKRKFKSESDIFIVDSIQEHFNIVLSQGNTKFRVKWQGYEAEKDWTWEPLENLRTPGEEMIRDYFDRLAGKPSALAAQASRVRTSPLRGGREFGILRDSYNTTTPAFHVSDHLST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.84
3 0.82
4 0.83
5 0.79
6 0.76
7 0.72
8 0.63
9 0.52
10 0.44
11 0.37
12 0.26
13 0.2
14 0.16
15 0.11
16 0.09
17 0.09
18 0.09
19 0.09
20 0.09
21 0.08
22 0.1
23 0.09
24 0.13
25 0.15
26 0.18
27 0.21
28 0.22
29 0.23
30 0.23
31 0.33
32 0.31
33 0.32
34 0.32
35 0.38
36 0.39
37 0.42
38 0.4
39 0.34
40 0.32
41 0.3
42 0.26
43 0.19
44 0.18
45 0.14
46 0.14
47 0.15
48 0.17
49 0.16
50 0.17
51 0.16
52 0.16
53 0.15
54 0.15
55 0.12
56 0.09
57 0.11
58 0.11
59 0.13
60 0.12
61 0.13
62 0.12
63 0.13
64 0.14
65 0.13
66 0.14
67 0.13
68 0.13
69 0.13
70 0.13
71 0.12
72 0.11
73 0.11
74 0.08
75 0.14
76 0.18
77 0.19
78 0.19
79 0.18
80 0.21
81 0.23
82 0.26
83 0.28
84 0.32
85 0.38
86 0.38
87 0.4
88 0.38
89 0.44
90 0.4
91 0.33
92 0.3
93 0.23
94 0.23
95 0.24
96 0.25
97 0.2
98 0.22
99 0.23
100 0.19
101 0.2
102 0.2
103 0.22
104 0.2
105 0.18
106 0.2