Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428TT43

Protein Details
Accession A0A428TT43    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
45-68IPLVLAQKRHKKSKKDPQYLWRDWHydrophilic
NLS Segment(s)
PositionSequence
52-59KRHKKSKK
Subcellular Location(s) mito 18, nucl 6, cyto 2
Family & Domain DBs
Amino Acid Sequences MPVDSKRALRVTGIPGGTTIAQYHEFVQSLSELPQKGHHSRLKSIPLVLAQKRHKKSKKDPQYLWRDWEITPNFQGITVLFQHADVDQIKMDICAIHALGGNAVDTWTAKNGKMWLRDYLPSTGYFSQSRVMTFGYDSDLTSKHLSFPRWTSCEKGTLETGRLSLPGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.26
3 0.27
4 0.25
5 0.2
6 0.15
7 0.12
8 0.13
9 0.13
10 0.15
11 0.15
12 0.15
13 0.14
14 0.14
15 0.13
16 0.12
17 0.14
18 0.16
19 0.14
20 0.15
21 0.21
22 0.26
23 0.28
24 0.36
25 0.38
26 0.39
27 0.44
28 0.5
29 0.5
30 0.46
31 0.44
32 0.38
33 0.37
34 0.4
35 0.38
36 0.39
37 0.41
38 0.49
39 0.54
40 0.62
41 0.65
42 0.68
43 0.76
44 0.79
45 0.82
46 0.82
47 0.84
48 0.83
49 0.86
50 0.79
51 0.73
52 0.64
53 0.55
54 0.45
55 0.46
56 0.38
57 0.29
58 0.27
59 0.23
60 0.2
61 0.18
62 0.18
63 0.09
64 0.1
65 0.08
66 0.08
67 0.07
68 0.07
69 0.07
70 0.07
71 0.09
72 0.07
73 0.07
74 0.06
75 0.07
76 0.07
77 0.06
78 0.06
79 0.04
80 0.04
81 0.04
82 0.04
83 0.05
84 0.06
85 0.06
86 0.06
87 0.06
88 0.06
89 0.05
90 0.05
91 0.04
92 0.04
93 0.04
94 0.07
95 0.09
96 0.09
97 0.11
98 0.16
99 0.21
100 0.26
101 0.28
102 0.29
103 0.31
104 0.33
105 0.34
106 0.32
107 0.28
108 0.24
109 0.26
110 0.23
111 0.23
112 0.21
113 0.2
114 0.22
115 0.21
116 0.21
117 0.18
118 0.17
119 0.15
120 0.14
121 0.14
122 0.13
123 0.13
124 0.13
125 0.14
126 0.14
127 0.16
128 0.19
129 0.18
130 0.2
131 0.24
132 0.27
133 0.3
134 0.35
135 0.41
136 0.43
137 0.45
138 0.45
139 0.43
140 0.47
141 0.44
142 0.41
143 0.39
144 0.38
145 0.39
146 0.35
147 0.33
148 0.27