Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428TXS9

Protein Details
Accession A0A428TXS9    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
11-35ASSPTSSPDKPRRWYSKKKVLSLTGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 8, mito 6, cyto 5, plas 2, pero 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007612  LOR  
IPR038595  LOR_sf  
IPR025659  Tubby-like_C  
Pfam View protein in Pfam  
PF04525  LOR  
Amino Acid Sequences MGSSPPPARSASSPTSSPDKPRRWYSKKKVLSLTGDSFDIKLANGQPILKVEGKMLSISGRKSVYDMQGNHLFDIVKKLLNIHTTFHVESPQGQVLMEVKSSFKLLGSKATATFTSTDGKQDVLEMKGGWLDYAADIMDKTTGTAVARIDRKLLSGKDIFFGQQTYALVVAPNVDMALMAALCICMDEKNNEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.42
3 0.42
4 0.48
5 0.51
6 0.53
7 0.56
8 0.65
9 0.72
10 0.75
11 0.83
12 0.84
13 0.85
14 0.86
15 0.86
16 0.83
17 0.79
18 0.76
19 0.72
20 0.65
21 0.56
22 0.49
23 0.41
24 0.34
25 0.27
26 0.21
27 0.13
28 0.12
29 0.11
30 0.12
31 0.13
32 0.13
33 0.14
34 0.15
35 0.19
36 0.18
37 0.17
38 0.15
39 0.16
40 0.16
41 0.15
42 0.14
43 0.14
44 0.15
45 0.15
46 0.17
47 0.16
48 0.16
49 0.18
50 0.21
51 0.22
52 0.26
53 0.26
54 0.28
55 0.34
56 0.34
57 0.32
58 0.29
59 0.25
60 0.18
61 0.22
62 0.17
63 0.12
64 0.11
65 0.13
66 0.14
67 0.18
68 0.19
69 0.15
70 0.17
71 0.19
72 0.2
73 0.19
74 0.18
75 0.14
76 0.14
77 0.15
78 0.14
79 0.11
80 0.1
81 0.1
82 0.1
83 0.1
84 0.09
85 0.07
86 0.06
87 0.07
88 0.07
89 0.07
90 0.06
91 0.08
92 0.08
93 0.12
94 0.13
95 0.14
96 0.15
97 0.16
98 0.15
99 0.14
100 0.15
101 0.12
102 0.13
103 0.12
104 0.13
105 0.12
106 0.13
107 0.11
108 0.12
109 0.13
110 0.11
111 0.11
112 0.1
113 0.1
114 0.1
115 0.1
116 0.08
117 0.06
118 0.06
119 0.05
120 0.05
121 0.05
122 0.04
123 0.04
124 0.05
125 0.05
126 0.05
127 0.05
128 0.05
129 0.06
130 0.06
131 0.08
132 0.09
133 0.15
134 0.18
135 0.18
136 0.2
137 0.19
138 0.21
139 0.25
140 0.25
141 0.24
142 0.25
143 0.26
144 0.25
145 0.26
146 0.25
147 0.2
148 0.2
149 0.15
150 0.14
151 0.13
152 0.12
153 0.12
154 0.11
155 0.1
156 0.09
157 0.1
158 0.07
159 0.07
160 0.06
161 0.05
162 0.05
163 0.05
164 0.06
165 0.04
166 0.04
167 0.04
168 0.04
169 0.04
170 0.05
171 0.05
172 0.06
173 0.09