Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428RCR8

Protein Details
Accession A0A428RCR8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MKYPPRRHRHRAHVSRAQSYTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 9.5, cyto_nucl 6
Family & Domain DBs
Amino Acid Sequences MKYPPRRHRHRAHVSRAQSYTTTQYRMAQRLRRPNVWSRHRQCRQFAGLPQWTHLRQRTVARLDPQSPAYQAAGDESPGYQDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.82
3 0.73
4 0.64
5 0.54
6 0.46
7 0.43
8 0.36
9 0.33
10 0.26
11 0.31
12 0.33
13 0.38
14 0.43
15 0.43
16 0.48
17 0.56
18 0.6
19 0.59
20 0.59
21 0.61
22 0.64
23 0.65
24 0.68
25 0.64
26 0.7
27 0.71
28 0.72
29 0.67
30 0.63
31 0.6
32 0.54
33 0.5
34 0.46
35 0.46
36 0.41
37 0.39
38 0.38
39 0.34
40 0.34
41 0.35
42 0.3
43 0.28
44 0.34
45 0.4
46 0.41
47 0.44
48 0.45
49 0.46
50 0.45
51 0.45
52 0.42
53 0.36
54 0.31
55 0.28
56 0.24
57 0.19
58 0.17
59 0.17
60 0.15
61 0.13
62 0.13
63 0.11