Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428SL98

Protein Details
Accession A0A428SL98    Localization Confidence Low Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
6-38DPVGTKKTTPPQPTRRPSRDDHKWKPRHSPSCPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9, nucl 6, plas 4, golg 3, pero 2, cyto 1, extr 1, E.R. 1
Family & Domain DBs
Amino Acid Sequences MRRLFDPVGTKKTTPPQPTRRPSRDDHKWKPRHSPSCPGIHQLSGPPVAVEMASTLSPGPRPLFSFSSTPLNLDATLLDLLLLLQVFCCCFGLEPTLSAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.6
3 0.64
4 0.7
5 0.79
6 0.84
7 0.82
8 0.78
9 0.76
10 0.76
11 0.77
12 0.77
13 0.78
14 0.78
15 0.8
16 0.8
17 0.84
18 0.84
19 0.82
20 0.76
21 0.75
22 0.69
23 0.69
24 0.66
25 0.59
26 0.5
27 0.41
28 0.36
29 0.28
30 0.25
31 0.17
32 0.15
33 0.11
34 0.09
35 0.08
36 0.07
37 0.06
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.05
44 0.05
45 0.07
46 0.08
47 0.08
48 0.1
49 0.14
50 0.17
51 0.19
52 0.2
53 0.21
54 0.27
55 0.26
56 0.25
57 0.21
58 0.2
59 0.18
60 0.16
61 0.14
62 0.09
63 0.09
64 0.08
65 0.07
66 0.05
67 0.05
68 0.06
69 0.06
70 0.03
71 0.04
72 0.05
73 0.05
74 0.06
75 0.07
76 0.06
77 0.07
78 0.09
79 0.14
80 0.14