Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A428U295

Protein Details
Accession A0A428U295    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
23-52EKVPSPTVPKVKKKKKWMWWWGKKKEKDPVBasic
NLS Segment(s)
PositionSequence
30-49VPKVKKKKKWMWWWGKKKEK
Subcellular Location(s) mito_nucl 14.5, mito 14, nucl 13
Family & Domain DBs
Amino Acid Sequences MSWRRISQSMGLVKAKEHNRLEEKVPSPTVPKVKKKKKWMWWWGKKKEKDPVEPEHHDVYNAPKNKEPEMIVRPESRPGMLEWLGGESLPVQSPQALKELFEQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.41
3 0.42
4 0.39
5 0.41
6 0.44
7 0.46
8 0.49
9 0.49
10 0.47
11 0.44
12 0.43
13 0.36
14 0.34
15 0.36
16 0.42
17 0.42
18 0.5
19 0.56
20 0.65
21 0.72
22 0.8
23 0.84
24 0.85
25 0.88
26 0.89
27 0.89
28 0.89
29 0.91
30 0.91
31 0.91
32 0.86
33 0.81
34 0.79
35 0.74
36 0.71
37 0.66
38 0.63
39 0.61
40 0.58
41 0.56
42 0.5
43 0.43
44 0.35
45 0.3
46 0.28
47 0.27
48 0.29
49 0.27
50 0.28
51 0.3
52 0.31
53 0.34
54 0.3
55 0.29
56 0.3
57 0.33
58 0.32
59 0.34
60 0.33
61 0.34
62 0.33
63 0.26
64 0.23
65 0.19
66 0.22
67 0.19
68 0.18
69 0.15
70 0.15
71 0.15
72 0.14
73 0.13
74 0.07
75 0.08
76 0.09
77 0.09
78 0.07
79 0.1
80 0.11
81 0.12
82 0.18
83 0.17
84 0.17