Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A428T4U1

Protein Details
Accession A0A428T4U1    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MKRLGYKKSRKGCLRCKQRRVKCDEKVPCTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 10.5, mito 7, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MKRLGYKKSRKGCLRCKQRRVKCDEKVPCTACCRHRVPCSLEGSGSVTPEVPSGRDRVPARQVATVFF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.89
3 0.9
4 0.91
5 0.9
6 0.89
7 0.88
8 0.87
9 0.84
10 0.83
11 0.82
12 0.76
13 0.74
14 0.67
15 0.61
16 0.56
17 0.53
18 0.47
19 0.44
20 0.43
21 0.41
22 0.43
23 0.45
24 0.46
25 0.46
26 0.46
27 0.41
28 0.37
29 0.32
30 0.3
31 0.25
32 0.21
33 0.15
34 0.11
35 0.1
36 0.12
37 0.11
38 0.09
39 0.1
40 0.13
41 0.14
42 0.22
43 0.24
44 0.29
45 0.36
46 0.41
47 0.42
48 0.44