Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428S955

Protein Details
Accession A0A428S955    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
107-126LEINRGYKDKHNKRNLRLLLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 11, mito 5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000589  Ribosomal_S15  
IPR005290  Ribosomal_S15_bac-type  
IPR009068  S15_NS1_RNA-bd  
Gene Ontology GO:0005737  C:cytoplasm  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00312  Ribosomal_S15  
Amino Acid Sequences MVESQIEPGTEEDKMKQHEQRHHKAVEALRRITSLSNSSAKDRFHANVRRIVAEFGRHNTDKVLKPKALSITPNELPMAPRSGPDTGSSEVQIAILTAKIRTLSQALEINRGYKDKHNKRNLRLLLHRRQKLLKYMDRRERGSERWTNMIEKLGLTPATWKNQIEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.32
3 0.37
4 0.43
5 0.51
6 0.6
7 0.66
8 0.68
9 0.65
10 0.61
11 0.61
12 0.6
13 0.6
14 0.57
15 0.5
16 0.42
17 0.41
18 0.4
19 0.34
20 0.31
21 0.24
22 0.22
23 0.24
24 0.25
25 0.28
26 0.31
27 0.3
28 0.29
29 0.29
30 0.27
31 0.31
32 0.38
33 0.37
34 0.4
35 0.41
36 0.42
37 0.39
38 0.39
39 0.31
40 0.28
41 0.27
42 0.23
43 0.28
44 0.26
45 0.25
46 0.25
47 0.3
48 0.31
49 0.35
50 0.37
51 0.32
52 0.32
53 0.35
54 0.37
55 0.33
56 0.29
57 0.27
58 0.28
59 0.27
60 0.27
61 0.24
62 0.21
63 0.19
64 0.18
65 0.18
66 0.11
67 0.11
68 0.12
69 0.13
70 0.13
71 0.13
72 0.15
73 0.13
74 0.14
75 0.14
76 0.12
77 0.11
78 0.11
79 0.09
80 0.06
81 0.05
82 0.05
83 0.05
84 0.05
85 0.05
86 0.06
87 0.06
88 0.07
89 0.08
90 0.07
91 0.1
92 0.15
93 0.16
94 0.2
95 0.2
96 0.21
97 0.21
98 0.22
99 0.21
100 0.23
101 0.34
102 0.4
103 0.5
104 0.59
105 0.67
106 0.72
107 0.8
108 0.78
109 0.75
110 0.75
111 0.75
112 0.75
113 0.76
114 0.74
115 0.69
116 0.69
117 0.65
118 0.63
119 0.63
120 0.61
121 0.61
122 0.67
123 0.73
124 0.73
125 0.72
126 0.71
127 0.68
128 0.63
129 0.62
130 0.6
131 0.54
132 0.54
133 0.53
134 0.48
135 0.44
136 0.43
137 0.35
138 0.28
139 0.25
140 0.22
141 0.2
142 0.17
143 0.22
144 0.24
145 0.29
146 0.32