Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A428SSJ5

Protein Details
Accession A0A428SSJ5    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
100-126FLYRTRSRTGRKILWRRKLKGRKNIAQHydrophilic
NLS Segment(s)
PositionSequence
97-123RHGFLYRTRSRTGRKILWRRKLKGRKN
Subcellular Location(s) mito 14.5, mito_nucl 12.333, nucl 9, cyto_nucl 6.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MNTMFRSVMRLTRPVLTSPLTQSPRTFTTFVPLRPSLTPSTIRRTLLPSSFTPSTATSADLVPSTAISAHPAMGDMQIRCGPRNTMNGATRLVQKRRHGFLYRTRSRTGRKILWRRKLKGRKNIAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.34
3 0.31
4 0.29
5 0.3
6 0.37
7 0.35
8 0.35
9 0.34
10 0.36
11 0.36
12 0.37
13 0.34
14 0.25
15 0.3
16 0.33
17 0.34
18 0.36
19 0.34
20 0.32
21 0.32
22 0.35
23 0.29
24 0.27
25 0.32
26 0.28
27 0.35
28 0.36
29 0.36
30 0.34
31 0.35
32 0.35
33 0.32
34 0.32
35 0.26
36 0.28
37 0.27
38 0.27
39 0.24
40 0.21
41 0.21
42 0.18
43 0.17
44 0.12
45 0.11
46 0.11
47 0.09
48 0.09
49 0.06
50 0.06
51 0.05
52 0.04
53 0.04
54 0.05
55 0.05
56 0.05
57 0.05
58 0.06
59 0.06
60 0.07
61 0.1
62 0.08
63 0.1
64 0.13
65 0.14
66 0.14
67 0.16
68 0.17
69 0.18
70 0.23
71 0.25
72 0.28
73 0.3
74 0.31
75 0.32
76 0.31
77 0.36
78 0.39
79 0.41
80 0.41
81 0.46
82 0.52
83 0.55
84 0.6
85 0.58
86 0.57
87 0.61
88 0.66
89 0.67
90 0.64
91 0.63
92 0.63
93 0.64
94 0.66
95 0.65
96 0.64
97 0.65
98 0.72
99 0.79
100 0.83
101 0.86
102 0.85
103 0.87
104 0.89
105 0.88
106 0.87