Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428T5W2

Protein Details
Accession A0A428T5W2    Localization Confidence High Confidence Score 22
NoLS Segment(s)
PositionSequenceProtein Nature
127-148ELEKQAKERRAAQRKRKAQEAIHydrophilic
163-189KTPAAPARPPPRPKKKSERTSWLPSPAHydrophilic
NLS Segment(s)
PositionSequence
130-180KQAKERRAAQRKRKAQEAIPAKFRKKVRIDPTTKTPAAPARPPPRPKKKSE
312-335AKEKRKRGEKAKGKDKDKGKGQDK
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR008895  Vps72/YL1  
IPR046757  YL1_N  
Gene Ontology GO:0005634  C:nucleus  
GO:0140849  F:ATP-dependent H2AZ histone chaperone activity  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF05764  YL1  
Amino Acid Sequences METESKLSEMGTPRSSSLSSLSDSDSDSETAKNLQRRSNDSDSQTNNEDKIEWLATTRKRRSTAGNRMKSMLANEEPDSDLELLFAEDENDQGFSDVGDNASDVHMDSSSDDEDNENNDDDLEGEKELEKQAKERRAAQRKRKAQEAIPAKFRKKVRIDPTTKTPAAPARPPPRPKKKSERTSWLPSPADLPTRASSRQTTRLSKEQLHQQMVEREARRLKQVAQMQKKAARLEALKKPPMTQEERLREAAIVEKRNSKSLNRWEVAEKQREEERRAKLAALHQRTLKGPVITFWSGIGEWMGRHMVIEEPAKEKRKRGEKAKGKDKDKGKGQDKSSAGEEKKDGNQEGITAAGDASSKAKAEEPQPTQQQPSTTPSLEPAAAPGAKEAEPSATPKVNDAVTKPSDPPSTASKTTSPTLKTEEPSRSMAMPPPPPPSGLAIPVPQPPPTPAPTPTPTPPPPSPLAPPTSGLAAPSPLPATAPPDTTQQAIITPPSGLARPPEPKPSGVLAAPILAPPLGISVNGTVPPMMGFSNPKSNVLAPPNTSQGVVPPTLSAVAPPPPSISPPVATPLAPKPTPAISSSTTDAAPKDILPQPISKPSDLPAKAPNTDPSAAPNPPEAEPQPPQPSTGARNAMVFQKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.32
3 0.28
4 0.26
5 0.24
6 0.22
7 0.22
8 0.23
9 0.22
10 0.22
11 0.23
12 0.21
13 0.19
14 0.18
15 0.16
16 0.16
17 0.2
18 0.25
19 0.3
20 0.33
21 0.38
22 0.44
23 0.5
24 0.58
25 0.6
26 0.61
27 0.6
28 0.64
29 0.62
30 0.61
31 0.58
32 0.53
33 0.46
34 0.39
35 0.34
36 0.27
37 0.27
38 0.22
39 0.18
40 0.18
41 0.25
42 0.32
43 0.42
44 0.48
45 0.52
46 0.54
47 0.58
48 0.65
49 0.68
50 0.71
51 0.72
52 0.73
53 0.69
54 0.68
55 0.66
56 0.58
57 0.49
58 0.45
59 0.37
60 0.31
61 0.29
62 0.28
63 0.27
64 0.26
65 0.25
66 0.19
67 0.16
68 0.12
69 0.11
70 0.09
71 0.08
72 0.08
73 0.06
74 0.06
75 0.06
76 0.07
77 0.07
78 0.07
79 0.07
80 0.07
81 0.06
82 0.07
83 0.08
84 0.07
85 0.07
86 0.07
87 0.07
88 0.08
89 0.08
90 0.06
91 0.07
92 0.07
93 0.07
94 0.07
95 0.09
96 0.1
97 0.1
98 0.11
99 0.11
100 0.12
101 0.14
102 0.16
103 0.14
104 0.13
105 0.12
106 0.12
107 0.11
108 0.12
109 0.1
110 0.08
111 0.08
112 0.09
113 0.11
114 0.14
115 0.18
116 0.17
117 0.23
118 0.31
119 0.38
120 0.41
121 0.49
122 0.57
123 0.63
124 0.73
125 0.77
126 0.8
127 0.82
128 0.83
129 0.82
130 0.77
131 0.7
132 0.7
133 0.69
134 0.64
135 0.64
136 0.67
137 0.61
138 0.62
139 0.6
140 0.6
141 0.58
142 0.61
143 0.61
144 0.65
145 0.69
146 0.68
147 0.74
148 0.73
149 0.66
150 0.56
151 0.51
152 0.46
153 0.45
154 0.45
155 0.46
156 0.46
157 0.54
158 0.63
159 0.7
160 0.75
161 0.77
162 0.8
163 0.82
164 0.84
165 0.85
166 0.86
167 0.85
168 0.82
169 0.84
170 0.8
171 0.77
172 0.67
173 0.57
174 0.49
175 0.42
176 0.37
177 0.29
178 0.27
179 0.22
180 0.24
181 0.25
182 0.26
183 0.28
184 0.3
185 0.38
186 0.42
187 0.45
188 0.47
189 0.54
190 0.56
191 0.55
192 0.55
193 0.55
194 0.56
195 0.52
196 0.48
197 0.44
198 0.43
199 0.42
200 0.44
201 0.36
202 0.33
203 0.35
204 0.35
205 0.35
206 0.32
207 0.32
208 0.32
209 0.38
210 0.44
211 0.48
212 0.51
213 0.53
214 0.55
215 0.56
216 0.5
217 0.44
218 0.38
219 0.33
220 0.35
221 0.39
222 0.42
223 0.43
224 0.42
225 0.43
226 0.43
227 0.45
228 0.44
229 0.42
230 0.44
231 0.46
232 0.49
233 0.48
234 0.45
235 0.38
236 0.33
237 0.32
238 0.28
239 0.26
240 0.24
241 0.3
242 0.31
243 0.34
244 0.36
245 0.32
246 0.35
247 0.41
248 0.48
249 0.41
250 0.42
251 0.42
252 0.48
253 0.53
254 0.52
255 0.43
256 0.37
257 0.42
258 0.43
259 0.45
260 0.44
261 0.42
262 0.38
263 0.38
264 0.36
265 0.33
266 0.37
267 0.4
268 0.37
269 0.36
270 0.33
271 0.34
272 0.34
273 0.35
274 0.31
275 0.23
276 0.18
277 0.17
278 0.21
279 0.19
280 0.19
281 0.15
282 0.13
283 0.12
284 0.12
285 0.11
286 0.06
287 0.05
288 0.06
289 0.06
290 0.05
291 0.05
292 0.05
293 0.05
294 0.08
295 0.09
296 0.1
297 0.13
298 0.18
299 0.25
300 0.26
301 0.28
302 0.33
303 0.42
304 0.47
305 0.54
306 0.6
307 0.63
308 0.72
309 0.79
310 0.8
311 0.74
312 0.74
313 0.7
314 0.66
315 0.65
316 0.64
317 0.61
318 0.59
319 0.58
320 0.59
321 0.54
322 0.49
323 0.43
324 0.41
325 0.34
326 0.29
327 0.28
328 0.23
329 0.25
330 0.26
331 0.23
332 0.17
333 0.17
334 0.15
335 0.14
336 0.12
337 0.09
338 0.06
339 0.05
340 0.05
341 0.05
342 0.04
343 0.05
344 0.05
345 0.05
346 0.06
347 0.08
348 0.1
349 0.13
350 0.21
351 0.24
352 0.3
353 0.35
354 0.36
355 0.36
356 0.36
357 0.34
358 0.29
359 0.29
360 0.27
361 0.23
362 0.21
363 0.21
364 0.21
365 0.19
366 0.16
367 0.13
368 0.12
369 0.11
370 0.11
371 0.1
372 0.1
373 0.1
374 0.1
375 0.1
376 0.09
377 0.09
378 0.12
379 0.15
380 0.15
381 0.15
382 0.16
383 0.18
384 0.17
385 0.18
386 0.17
387 0.2
388 0.2
389 0.22
390 0.22
391 0.24
392 0.24
393 0.24
394 0.25
395 0.24
396 0.28
397 0.27
398 0.29
399 0.27
400 0.29
401 0.31
402 0.33
403 0.29
404 0.25
405 0.3
406 0.31
407 0.3
408 0.33
409 0.35
410 0.34
411 0.35
412 0.34
413 0.29
414 0.27
415 0.29
416 0.29
417 0.29
418 0.29
419 0.31
420 0.31
421 0.3
422 0.3
423 0.29
424 0.25
425 0.23
426 0.21
427 0.18
428 0.2
429 0.24
430 0.24
431 0.21
432 0.2
433 0.2
434 0.22
435 0.24
436 0.25
437 0.23
438 0.28
439 0.3
440 0.34
441 0.35
442 0.39
443 0.39
444 0.43
445 0.42
446 0.4
447 0.4
448 0.38
449 0.4
450 0.36
451 0.37
452 0.31
453 0.31
454 0.27
455 0.26
456 0.23
457 0.19
458 0.15
459 0.12
460 0.11
461 0.11
462 0.11
463 0.08
464 0.09
465 0.09
466 0.13
467 0.14
468 0.16
469 0.16
470 0.2
471 0.21
472 0.21
473 0.22
474 0.17
475 0.16
476 0.15
477 0.15
478 0.11
479 0.1
480 0.1
481 0.11
482 0.11
483 0.1
484 0.12
485 0.18
486 0.22
487 0.25
488 0.33
489 0.34
490 0.34
491 0.37
492 0.37
493 0.34
494 0.29
495 0.28
496 0.2
497 0.19
498 0.18
499 0.14
500 0.12
501 0.08
502 0.08
503 0.06
504 0.07
505 0.06
506 0.05
507 0.06
508 0.07
509 0.09
510 0.1
511 0.1
512 0.09
513 0.09
514 0.09
515 0.09
516 0.08
517 0.08
518 0.12
519 0.15
520 0.24
521 0.25
522 0.27
523 0.28
524 0.29
525 0.34
526 0.37
527 0.38
528 0.32
529 0.35
530 0.37
531 0.35
532 0.34
533 0.27
534 0.25
535 0.24
536 0.21
537 0.18
538 0.15
539 0.15
540 0.15
541 0.15
542 0.12
543 0.11
544 0.15
545 0.16
546 0.17
547 0.19
548 0.19
549 0.21
550 0.25
551 0.24
552 0.2
553 0.21
554 0.25
555 0.24
556 0.23
557 0.25
558 0.28
559 0.33
560 0.32
561 0.31
562 0.29
563 0.31
564 0.34
565 0.31
566 0.29
567 0.24
568 0.28
569 0.3
570 0.29
571 0.26
572 0.26
573 0.24
574 0.22
575 0.2
576 0.16
577 0.2
578 0.23
579 0.27
580 0.27
581 0.31
582 0.33
583 0.42
584 0.45
585 0.4
586 0.36
587 0.36
588 0.44
589 0.41
590 0.4
591 0.38
592 0.41
593 0.42
594 0.44
595 0.45
596 0.41
597 0.41
598 0.38
599 0.37
600 0.37
601 0.36
602 0.35
603 0.34
604 0.31
605 0.31
606 0.37
607 0.32
608 0.32
609 0.35
610 0.42
611 0.45
612 0.42
613 0.43
614 0.4
615 0.44
616 0.42
617 0.46
618 0.44
619 0.37
620 0.39
621 0.39