Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G7Y1A0

Protein Details
Accession G7Y1A0   
Localization Confidence Low
Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
108-135LEKKHPFRRLLSHEKKHIRNKISKEWEHBasic
NLS Segment(s)
PositionSequence
121-125EKKHI
Subcellular Location(s) cyto 11.5, cyto_nucl 9.5, nucl 4.5, mito 3, extr 3, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR012337  RNaseH-like_sf  
IPR036397  RNaseH_sf  
Gene Ontology GO:0016020  C:membrane  
GO:0003676  F:nucleic acid binding  
GO:0003964  F:RNA-directed DNA polymerase activity  
CDD cd09276  Rnase_HI_RT_non_LTR  
Amino Acid Sequences MEYWSVYAAELLAIYYAIGLVFHLAQKSPAAATTTRGPATILSDSMSALQVIANSWNKSNQRNIQAIHQSAGELKPREIPLRFQWVPGPCGDPGNDTAARLAEEAAGLEKKHPFRRLLSHEKKHIRNKISKEWEHE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.03
5 0.03
6 0.03
7 0.04
8 0.05
9 0.06
10 0.07
11 0.07
12 0.09
13 0.09
14 0.1
15 0.09
16 0.1
17 0.12
18 0.11
19 0.14
20 0.18
21 0.21
22 0.21
23 0.21
24 0.2
25 0.17
26 0.21
27 0.19
28 0.14
29 0.11
30 0.11
31 0.11
32 0.11
33 0.11
34 0.07
35 0.06
36 0.06
37 0.05
38 0.05
39 0.09
40 0.12
41 0.12
42 0.13
43 0.18
44 0.2
45 0.23
46 0.29
47 0.31
48 0.34
49 0.36
50 0.37
51 0.38
52 0.4
53 0.38
54 0.32
55 0.26
56 0.21
57 0.18
58 0.19
59 0.17
60 0.13
61 0.13
62 0.16
63 0.18
64 0.21
65 0.21
66 0.23
67 0.23
68 0.31
69 0.31
70 0.28
71 0.32
72 0.31
73 0.31
74 0.29
75 0.27
76 0.18
77 0.19
78 0.18
79 0.15
80 0.14
81 0.18
82 0.17
83 0.15
84 0.15
85 0.14
86 0.14
87 0.13
88 0.12
89 0.07
90 0.06
91 0.06
92 0.08
93 0.09
94 0.09
95 0.11
96 0.16
97 0.23
98 0.3
99 0.35
100 0.36
101 0.4
102 0.5
103 0.57
104 0.63
105 0.67
106 0.69
107 0.75
108 0.81
109 0.85
110 0.85
111 0.85
112 0.83
113 0.82
114 0.81
115 0.82
116 0.83