Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428RPQ5

Protein Details
Accession A0A428RPQ5    Localization Confidence High Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
3-24HSSKHGKSKSGRSKRDDGKRAGBasic
NLS Segment(s)
PositionSequence
6-29KHGKSKSGRSKRDDGKRAGGREKT
Subcellular Location(s) nucl 20, mito 5
Family & Domain DBs
Amino Acid Sequences MGHSSKHGKSKSGRSKRDDGKRAGGREKTARPSITQLQALIANIEERQLSLARQHEEYTRLQEQAEKSARAPGGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.79
3 0.81
4 0.84
5 0.81
6 0.75
7 0.75
8 0.73
9 0.71
10 0.69
11 0.62
12 0.56
13 0.55
14 0.55
15 0.51
16 0.49
17 0.44
18 0.38
19 0.4
20 0.4
21 0.37
22 0.32
23 0.26
24 0.22
25 0.22
26 0.2
27 0.15
28 0.1
29 0.07
30 0.06
31 0.06
32 0.05
33 0.05
34 0.06
35 0.06
36 0.07
37 0.11
38 0.15
39 0.17
40 0.19
41 0.2
42 0.21
43 0.24
44 0.26
45 0.29
46 0.27
47 0.26
48 0.25
49 0.29
50 0.28
51 0.34
52 0.37
53 0.32
54 0.3
55 0.36