Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A428STP9

Protein Details
Accession A0A428STP9    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MSVLRPLRSFRRRIRRPTSPSVREKAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 5, cyto 3
Family & Domain DBs
Amino Acid Sequences MSVLRPLRSFRRRIRRPTSPSVREKATAVEENLEPVVSEPVVPEPEVFNQTIDIGDSATGTSPRLSDLEEVQSNRTGEITPVVLRVQQRATGRDRPREETPAEAIPAEEPLAEELPTDRIPGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.84
3 0.85
4 0.87
5 0.87
6 0.85
7 0.84
8 0.78
9 0.72
10 0.63
11 0.56
12 0.48
13 0.43
14 0.37
15 0.3
16 0.28
17 0.24
18 0.23
19 0.22
20 0.18
21 0.13
22 0.1
23 0.1
24 0.07
25 0.07
26 0.06
27 0.08
28 0.09
29 0.09
30 0.08
31 0.09
32 0.11
33 0.13
34 0.13
35 0.11
36 0.1
37 0.1
38 0.1
39 0.09
40 0.07
41 0.05
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.05
48 0.05
49 0.05
50 0.05
51 0.06
52 0.07
53 0.07
54 0.08
55 0.12
56 0.15
57 0.15
58 0.16
59 0.19
60 0.18
61 0.17
62 0.16
63 0.12
64 0.1
65 0.11
66 0.11
67 0.08
68 0.09
69 0.1
70 0.12
71 0.12
72 0.15
73 0.15
74 0.18
75 0.21
76 0.24
77 0.29
78 0.36
79 0.43
80 0.49
81 0.52
82 0.53
83 0.56
84 0.57
85 0.53
86 0.47
87 0.45
88 0.38
89 0.35
90 0.29
91 0.24
92 0.19
93 0.18
94 0.14
95 0.1
96 0.08
97 0.09
98 0.1
99 0.1
100 0.1
101 0.1
102 0.14
103 0.14