Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428RFU4

Protein Details
Accession A0A428RFU4    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
21-47AVTITRNNEREKKKKRLPPQVSIDRTWHydrophilic
NLS Segment(s)
PositionSequence
31-36EKKKKR
Subcellular Location(s) nucl 20.5, cyto_nucl 12, cyto 2.5, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR038765  Papain-like_cys_pep_sf  
IPR001300  Peptidase_C2_calpain_cat  
Gene Ontology GO:0004198  F:calcium-dependent cysteine-type endopeptidase activity  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF00648  Peptidase_C2  
PROSITE View protein in PROSITE  
PS50203  CALPAIN_CAT  
Amino Acid Sequences MNGHSSSEESDDSGRPQVQPAVTITRNNEREKKKKRLPPQVSIDRTWGRFSRYHSGNPLAVLPAGRVPVSATYQGQSNELLSDAYERAADECRRTVQKRVERCKRDGMRYEDSEWDLDRDLKQKKGHCLNGLCSQLFKLDKDTLLSSSPSTPKSVKRVHEIFENPTFMKNVNGGDVKQGTLDDCWLMGALTALGNVQDELKRICVAYDTE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.21
3 0.23
4 0.26
5 0.23
6 0.24
7 0.25
8 0.28
9 0.29
10 0.32
11 0.34
12 0.39
13 0.45
14 0.49
15 0.55
16 0.57
17 0.65
18 0.71
19 0.78
20 0.78
21 0.82
22 0.86
23 0.88
24 0.87
25 0.86
26 0.87
27 0.86
28 0.81
29 0.74
30 0.7
31 0.64
32 0.57
33 0.51
34 0.43
35 0.36
36 0.35
37 0.38
38 0.4
39 0.39
40 0.42
41 0.42
42 0.44
43 0.41
44 0.38
45 0.33
46 0.24
47 0.21
48 0.17
49 0.13
50 0.1
51 0.1
52 0.09
53 0.08
54 0.08
55 0.09
56 0.11
57 0.13
58 0.12
59 0.12
60 0.14
61 0.15
62 0.15
63 0.13
64 0.11
65 0.1
66 0.09
67 0.09
68 0.06
69 0.07
70 0.06
71 0.06
72 0.06
73 0.06
74 0.07
75 0.11
76 0.12
77 0.12
78 0.13
79 0.16
80 0.22
81 0.24
82 0.3
83 0.35
84 0.41
85 0.5
86 0.59
87 0.66
88 0.65
89 0.67
90 0.71
91 0.67
92 0.66
93 0.63
94 0.6
95 0.55
96 0.53
97 0.51
98 0.43
99 0.39
100 0.33
101 0.26
102 0.2
103 0.14
104 0.13
105 0.12
106 0.17
107 0.19
108 0.23
109 0.28
110 0.31
111 0.39
112 0.46
113 0.49
114 0.49
115 0.49
116 0.48
117 0.51
118 0.5
119 0.41
120 0.33
121 0.29
122 0.27
123 0.25
124 0.21
125 0.18
126 0.17
127 0.17
128 0.19
129 0.2
130 0.17
131 0.18
132 0.18
133 0.15
134 0.18
135 0.2
136 0.19
137 0.21
138 0.23
139 0.26
140 0.34
141 0.4
142 0.4
143 0.45
144 0.48
145 0.47
146 0.52
147 0.51
148 0.48
149 0.45
150 0.45
151 0.37
152 0.35
153 0.33
154 0.25
155 0.24
156 0.2
157 0.16
158 0.17
159 0.19
160 0.17
161 0.22
162 0.23
163 0.21
164 0.19
165 0.19
166 0.15
167 0.14
168 0.15
169 0.1
170 0.08
171 0.08
172 0.08
173 0.07
174 0.06
175 0.06
176 0.05
177 0.05
178 0.05
179 0.05
180 0.05
181 0.06
182 0.06
183 0.08
184 0.09
185 0.11
186 0.13
187 0.15
188 0.16
189 0.16
190 0.16