Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A7TLL0

Protein Details
Accession A7TLL0    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
95-116TSEIEIKRKIEKNRRSRHFNNVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR020491  BLI1  
Gene Ontology GO:0005768  C:endosome  
KEGG vpo:Kpol_1056p2  -  
Pfam View protein in Pfam  
PF17324  BLI1  
Amino Acid Sequences MREQERKLSNGIEHCLSKTQEYVDMESAKAISIFSSKVNSNGRWLAEISGKYELKESGELEAFRLLKEDHVKMLDQLEGKIEYYEKLLDELTEFTSEIEIKRKIEKNRRSRHFNNV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.35
3 0.33
4 0.29
5 0.25
6 0.23
7 0.25
8 0.25
9 0.27
10 0.26
11 0.25
12 0.24
13 0.23
14 0.21
15 0.15
16 0.13
17 0.1
18 0.06
19 0.06
20 0.07
21 0.08
22 0.11
23 0.11
24 0.17
25 0.21
26 0.21
27 0.24
28 0.26
29 0.25
30 0.24
31 0.24
32 0.2
33 0.19
34 0.19
35 0.17
36 0.19
37 0.19
38 0.18
39 0.18
40 0.17
41 0.14
42 0.15
43 0.14
44 0.1
45 0.11
46 0.11
47 0.11
48 0.13
49 0.12
50 0.11
51 0.11
52 0.1
53 0.11
54 0.15
55 0.15
56 0.14
57 0.15
58 0.16
59 0.15
60 0.16
61 0.16
62 0.13
63 0.12
64 0.13
65 0.12
66 0.12
67 0.12
68 0.11
69 0.09
70 0.1
71 0.11
72 0.09
73 0.09
74 0.09
75 0.09
76 0.09
77 0.1
78 0.11
79 0.11
80 0.11
81 0.1
82 0.11
83 0.12
84 0.12
85 0.17
86 0.18
87 0.19
88 0.28
89 0.35
90 0.44
91 0.54
92 0.63
93 0.68
94 0.76
95 0.84
96 0.85