Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428SHM9

Protein Details
Accession A0A428SHM9    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
106-165LQSSQEPPKKPRRKRKTQLTAPIFANKTRKIKKVRERNRVAANKFRTRKKKDLARLQSDEHydrophilic
NLS Segment(s)
PositionSequence
113-156PKKPRRKRKTQLTAPIFANKTRKIKKVRERNRVAANKFRTRKKK
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF00170  bZIP_1  
PROSITE View protein in PROSITE  
PS50217  BZIP  
PS00036  BZIP_BASIC  
CDD cd14687  bZIP_ATF2  
Amino Acid Sequences MNSFPYMEGVTLLHGYTPNEAIGDELTAGSAAVPSHPRWEGSEWIDRRPFLGAFQDDVDFTASYRQARLPHDHSVFYGATVKNHALSSERLVTVPDEPPSTVTPSLQSSQEPPKKPRRKRKTQLTAPIFANKTRKIKKVRERNRVAANKFRTRKKKDLARLQSDEEAIEQRHRTLTSCVDDLNEELLQLKMQLLQHTACNCTLMQNYIENEAQLYIQSMELESQNYRDGYNQAEDLHYP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.13
4 0.14
5 0.12
6 0.12
7 0.11
8 0.11
9 0.1
10 0.1
11 0.08
12 0.07
13 0.06
14 0.06
15 0.06
16 0.05
17 0.05
18 0.05
19 0.07
20 0.1
21 0.11
22 0.16
23 0.17
24 0.18
25 0.2
26 0.24
27 0.27
28 0.29
29 0.38
30 0.35
31 0.41
32 0.43
33 0.4
34 0.37
35 0.34
36 0.3
37 0.22
38 0.27
39 0.22
40 0.2
41 0.21
42 0.21
43 0.18
44 0.19
45 0.19
46 0.12
47 0.1
48 0.13
49 0.13
50 0.13
51 0.14
52 0.17
53 0.19
54 0.24
55 0.3
56 0.31
57 0.38
58 0.39
59 0.38
60 0.36
61 0.35
62 0.31
63 0.25
64 0.26
65 0.18
66 0.17
67 0.18
68 0.18
69 0.16
70 0.16
71 0.16
72 0.12
73 0.13
74 0.16
75 0.17
76 0.17
77 0.15
78 0.16
79 0.16
80 0.16
81 0.17
82 0.14
83 0.12
84 0.11
85 0.13
86 0.14
87 0.16
88 0.14
89 0.12
90 0.13
91 0.14
92 0.16
93 0.15
94 0.14
95 0.15
96 0.24
97 0.31
98 0.34
99 0.38
100 0.47
101 0.57
102 0.66
103 0.74
104 0.75
105 0.79
106 0.85
107 0.9
108 0.9
109 0.89
110 0.9
111 0.84
112 0.78
113 0.68
114 0.64
115 0.53
116 0.45
117 0.41
118 0.35
119 0.39
120 0.39
121 0.45
122 0.48
123 0.57
124 0.64
125 0.71
126 0.76
127 0.78
128 0.8
129 0.8
130 0.82
131 0.8
132 0.74
133 0.72
134 0.69
135 0.68
136 0.67
137 0.69
138 0.69
139 0.69
140 0.74
141 0.74
142 0.77
143 0.77
144 0.81
145 0.82
146 0.8
147 0.76
148 0.7
149 0.63
150 0.54
151 0.44
152 0.34
153 0.27
154 0.19
155 0.19
156 0.16
157 0.15
158 0.16
159 0.17
160 0.17
161 0.18
162 0.23
163 0.23
164 0.23
165 0.22
166 0.21
167 0.21
168 0.2
169 0.2
170 0.14
171 0.1
172 0.1
173 0.1
174 0.09
175 0.09
176 0.08
177 0.09
178 0.11
179 0.13
180 0.14
181 0.15
182 0.2
183 0.21
184 0.23
185 0.2
186 0.2
187 0.18
188 0.2
189 0.2
190 0.18
191 0.18
192 0.2
193 0.21
194 0.24
195 0.24
196 0.2
197 0.19
198 0.17
199 0.16
200 0.11
201 0.12
202 0.08
203 0.09
204 0.09
205 0.09
206 0.1
207 0.11
208 0.13
209 0.12
210 0.13
211 0.17
212 0.17
213 0.17
214 0.18
215 0.19
216 0.21
217 0.24
218 0.24
219 0.21