Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428S9Y0

Protein Details
Accession A0A428S9Y0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
63-107LPPPRLPRPRLPPLRRPPRRRPTPPRPPPPRPPRRRPWWFPKPWWBasic
NLS Segment(s)
PositionSequence
64-100PPPRLPRPRLPPLRRPPRRRPTPPRPPPPRPPRRRPW
Subcellular Location(s) extr 13, plas 7, mito 3, E.R. 2, golg 2
Family & Domain DBs
Amino Acid Sequences MHLFQVIVSSMLISGCMALAFPNYDMKAGLPHSRDEPDAPAKLDDRAEVAPRLPDPLLRGPWLPPPRLPRPRLPPLRRPPRRRPTPPRPPPPRPPRRRPWWFPKPWWPTPPPYLPPDPPETTPPPNPPPNPPPNPPETDPTPPNPPETDLPPVNPPETDPTPTPIPPPIPPVNPPVLSPPPIQTPDTPIPPVNPPETDPNTSIPPPPPPPPTSPTPPPNPANPPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.04
5 0.04
6 0.06
7 0.07
8 0.08
9 0.12
10 0.13
11 0.13
12 0.14
13 0.14
14 0.17
15 0.18
16 0.23
17 0.21
18 0.23
19 0.26
20 0.28
21 0.29
22 0.27
23 0.3
24 0.3
25 0.31
26 0.3
27 0.29
28 0.27
29 0.28
30 0.27
31 0.22
32 0.18
33 0.18
34 0.19
35 0.18
36 0.18
37 0.18
38 0.17
39 0.2
40 0.17
41 0.16
42 0.18
43 0.23
44 0.24
45 0.24
46 0.24
47 0.23
48 0.32
49 0.36
50 0.33
51 0.32
52 0.37
53 0.46
54 0.54
55 0.56
56 0.56
57 0.6
58 0.68
59 0.75
60 0.74
61 0.74
62 0.76
63 0.84
64 0.85
65 0.86
66 0.86
67 0.86
68 0.9
69 0.9
70 0.9
71 0.89
72 0.91
73 0.92
74 0.92
75 0.9
76 0.88
77 0.88
78 0.89
79 0.89
80 0.87
81 0.86
82 0.85
83 0.86
84 0.88
85 0.85
86 0.85
87 0.85
88 0.82
89 0.79
90 0.8
91 0.78
92 0.74
93 0.71
94 0.63
95 0.57
96 0.55
97 0.53
98 0.46
99 0.41
100 0.39
101 0.35
102 0.35
103 0.36
104 0.32
105 0.28
106 0.3
107 0.3
108 0.31
109 0.33
110 0.35
111 0.35
112 0.39
113 0.4
114 0.41
115 0.45
116 0.5
117 0.52
118 0.51
119 0.49
120 0.47
121 0.5
122 0.46
123 0.43
124 0.38
125 0.38
126 0.37
127 0.37
128 0.39
129 0.35
130 0.35
131 0.31
132 0.29
133 0.26
134 0.27
135 0.29
136 0.24
137 0.25
138 0.26
139 0.27
140 0.24
141 0.22
142 0.2
143 0.21
144 0.22
145 0.24
146 0.21
147 0.24
148 0.26
149 0.27
150 0.27
151 0.24
152 0.25
153 0.23
154 0.29
155 0.29
156 0.29
157 0.31
158 0.34
159 0.36
160 0.34
161 0.33
162 0.33
163 0.32
164 0.33
165 0.32
166 0.3
167 0.3
168 0.33
169 0.34
170 0.28
171 0.32
172 0.34
173 0.37
174 0.36
175 0.32
176 0.31
177 0.34
178 0.37
179 0.33
180 0.29
181 0.27
182 0.34
183 0.38
184 0.39
185 0.36
186 0.36
187 0.37
188 0.37
189 0.39
190 0.33
191 0.35
192 0.37
193 0.41
194 0.44
195 0.44
196 0.48
197 0.49
198 0.54
199 0.55
200 0.58
201 0.6
202 0.62
203 0.65
204 0.64
205 0.66