Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428TAN4

Protein Details
Accession A0A428TAN4    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
4-32WLSLRLTLRDYKKKKKAWQAIRKPPPEQPHydrophilic
NLS Segment(s)
PositionSequence
15-26KKKKKAWQAIRK
Subcellular Location(s) nucl 14, mito 8, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013218  Dsn1/Mis13  
Gene Ontology GO:0000444  C:MIS12/MIND type complex  
GO:0051301  P:cell division  
GO:0007059  P:chromosome segregation  
Pfam View protein in Pfam  
PF08202  MIS13  
Amino Acid Sequences MRNWLSLRLTLRDYKKKKKAWQAIRKPPPEQPPLFTEGEETGPIVLPDFDLLDPEEGKIRGLLADETASFDVIRSQTETRLRTIQSSLEFQVDQLADNVHKLEQRVLVAGKEADKVLSISALRLRQREEREKASAGTREMPMMEVLRSLGNILPEGGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.72
3 0.77
4 0.82
5 0.85
6 0.87
7 0.87
8 0.9
9 0.9
10 0.91
11 0.92
12 0.89
13 0.82
14 0.79
15 0.76
16 0.74
17 0.65
18 0.57
19 0.51
20 0.5
21 0.47
22 0.39
23 0.32
24 0.25
25 0.23
26 0.2
27 0.16
28 0.1
29 0.1
30 0.09
31 0.08
32 0.06
33 0.05
34 0.05
35 0.06
36 0.05
37 0.06
38 0.07
39 0.07
40 0.08
41 0.08
42 0.1
43 0.09
44 0.09
45 0.08
46 0.08
47 0.07
48 0.08
49 0.08
50 0.06
51 0.06
52 0.06
53 0.08
54 0.08
55 0.08
56 0.07
57 0.06
58 0.08
59 0.07
60 0.08
61 0.09
62 0.09
63 0.13
64 0.18
65 0.2
66 0.2
67 0.23
68 0.23
69 0.22
70 0.22
71 0.21
72 0.18
73 0.19
74 0.18
75 0.16
76 0.16
77 0.14
78 0.16
79 0.13
80 0.12
81 0.1
82 0.09
83 0.08
84 0.09
85 0.09
86 0.07
87 0.09
88 0.09
89 0.11
90 0.12
91 0.12
92 0.14
93 0.14
94 0.13
95 0.13
96 0.14
97 0.13
98 0.12
99 0.11
100 0.1
101 0.09
102 0.09
103 0.08
104 0.09
105 0.08
106 0.09
107 0.13
108 0.19
109 0.21
110 0.23
111 0.27
112 0.33
113 0.41
114 0.49
115 0.52
116 0.52
117 0.54
118 0.54
119 0.53
120 0.51
121 0.47
122 0.4
123 0.38
124 0.32
125 0.29
126 0.27
127 0.25
128 0.21
129 0.19
130 0.16
131 0.12
132 0.12
133 0.11
134 0.11
135 0.11
136 0.11
137 0.11
138 0.11