Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A428UAJ1

Protein Details
Accession A0A428UAJ1    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
151-181TQRYKRKPFSDDPNKKKRKRNARERDLCDVKBasic
262-282AKQERETKKAQKPPSRKTTGAHydrophilic
NLS Segment(s)
PositionSequence
155-173KRKPFSDDPNKKKRKRNAR
269-278KKAQKPPSRK
Subcellular Location(s) cyto 12, mito 8.5, mito_nucl 7, cyto_pero 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR004045  Glutathione_S-Trfase_N  
IPR036249  Thioredoxin-like_sf  
Pfam View protein in Pfam  
PF13417  GST_N_3  
PROSITE View protein in PROSITE  
PS50404  GST_NTER  
CDD cd00570  GST_N_family  
Amino Acid Sequences MAAPSAPGPGSGPFAAQYHRVALGIGLEGYVAPDLDEAYRLHAAQSGAAVTAPAPHHHAPGQFGILAPTAVPVPVPVVETQQIQGVFGAQLPSQQVERSNGQLSSKIVVDPPDLEAWRDKLFNVDEMIVLTHEQFETYFPHVDNVYSHRSTQRYKRKPFSDDPNKKKRKRNARERDLCDVKIKITEYLPGAELQLEPSDQGQSGPAILGGFAGVAGQQRFWTVQRVNGNGGNGKGDGVAGPHKHTLEKSDEIKKNSVQRYLAKQERETKKAQKPPSRKTTGAALATARKHAKENALKLYGACFCPFSQRVWITLEAKGMAYQYCETDPFRRPAPTHLLEANPHGCVPAIRQGEWTCAESSVILEYVRRQVHARNGMPNTLAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.2
4 0.2
5 0.19
6 0.19
7 0.19
8 0.17
9 0.16
10 0.15
11 0.13
12 0.11
13 0.08
14 0.07
15 0.07
16 0.07
17 0.07
18 0.06
19 0.04
20 0.05
21 0.06
22 0.06
23 0.08
24 0.08
25 0.12
26 0.14
27 0.14
28 0.14
29 0.17
30 0.17
31 0.15
32 0.16
33 0.13
34 0.11
35 0.11
36 0.11
37 0.07
38 0.12
39 0.12
40 0.12
41 0.18
42 0.19
43 0.21
44 0.24
45 0.26
46 0.24
47 0.26
48 0.26
49 0.21
50 0.2
51 0.19
52 0.16
53 0.14
54 0.11
55 0.09
56 0.07
57 0.07
58 0.07
59 0.05
60 0.06
61 0.07
62 0.08
63 0.08
64 0.11
65 0.13
66 0.14
67 0.14
68 0.16
69 0.16
70 0.14
71 0.14
72 0.12
73 0.1
74 0.1
75 0.12
76 0.08
77 0.1
78 0.1
79 0.12
80 0.11
81 0.12
82 0.14
83 0.17
84 0.19
85 0.21
86 0.23
87 0.23
88 0.23
89 0.25
90 0.23
91 0.21
92 0.19
93 0.16
94 0.15
95 0.15
96 0.15
97 0.13
98 0.14
99 0.16
100 0.15
101 0.16
102 0.17
103 0.18
104 0.19
105 0.18
106 0.16
107 0.17
108 0.18
109 0.18
110 0.17
111 0.15
112 0.13
113 0.13
114 0.13
115 0.09
116 0.09
117 0.07
118 0.07
119 0.06
120 0.06
121 0.06
122 0.06
123 0.09
124 0.11
125 0.13
126 0.12
127 0.14
128 0.14
129 0.14
130 0.15
131 0.16
132 0.19
133 0.19
134 0.2
135 0.22
136 0.26
137 0.3
138 0.39
139 0.46
140 0.5
141 0.58
142 0.66
143 0.68
144 0.72
145 0.74
146 0.75
147 0.76
148 0.76
149 0.77
150 0.79
151 0.83
152 0.84
153 0.86
154 0.84
155 0.84
156 0.84
157 0.86
158 0.86
159 0.87
160 0.9
161 0.86
162 0.86
163 0.78
164 0.69
165 0.61
166 0.5
167 0.39
168 0.32
169 0.27
170 0.19
171 0.15
172 0.16
173 0.13
174 0.13
175 0.13
176 0.11
177 0.1
178 0.09
179 0.09
180 0.07
181 0.07
182 0.06
183 0.05
184 0.05
185 0.06
186 0.05
187 0.06
188 0.05
189 0.05
190 0.05
191 0.05
192 0.05
193 0.04
194 0.04
195 0.04
196 0.03
197 0.03
198 0.02
199 0.02
200 0.03
201 0.04
202 0.04
203 0.05
204 0.05
205 0.06
206 0.07
207 0.08
208 0.14
209 0.13
210 0.19
211 0.23
212 0.25
213 0.27
214 0.28
215 0.28
216 0.24
217 0.23
218 0.19
219 0.14
220 0.13
221 0.1
222 0.08
223 0.07
224 0.07
225 0.1
226 0.1
227 0.12
228 0.14
229 0.15
230 0.16
231 0.16
232 0.19
233 0.21
234 0.25
235 0.29
236 0.37
237 0.41
238 0.43
239 0.47
240 0.47
241 0.5
242 0.49
243 0.48
244 0.42
245 0.43
246 0.47
247 0.53
248 0.55
249 0.5
250 0.52
251 0.57
252 0.6
253 0.6
254 0.58
255 0.59
256 0.62
257 0.67
258 0.72
259 0.72
260 0.75
261 0.8
262 0.83
263 0.81
264 0.73
265 0.66
266 0.64
267 0.61
268 0.53
269 0.44
270 0.37
271 0.35
272 0.35
273 0.38
274 0.32
275 0.26
276 0.28
277 0.29
278 0.36
279 0.38
280 0.44
281 0.46
282 0.46
283 0.45
284 0.43
285 0.43
286 0.37
287 0.31
288 0.25
289 0.19
290 0.17
291 0.24
292 0.25
293 0.24
294 0.29
295 0.29
296 0.3
297 0.32
298 0.37
299 0.31
300 0.32
301 0.32
302 0.24
303 0.23
304 0.21
305 0.19
306 0.14
307 0.14
308 0.13
309 0.13
310 0.14
311 0.16
312 0.18
313 0.23
314 0.28
315 0.3
316 0.33
317 0.36
318 0.37
319 0.41
320 0.47
321 0.45
322 0.44
323 0.44
324 0.44
325 0.4
326 0.45
327 0.4
328 0.31
329 0.28
330 0.23
331 0.2
332 0.17
333 0.19
334 0.21
335 0.22
336 0.22
337 0.27
338 0.28
339 0.33
340 0.35
341 0.34
342 0.26
343 0.24
344 0.23
345 0.18
346 0.18
347 0.15
348 0.13
349 0.11
350 0.11
351 0.14
352 0.21
353 0.23
354 0.24
355 0.24
356 0.29
357 0.39
358 0.48
359 0.49
360 0.51
361 0.53
362 0.54