Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G7XW26

Protein Details
Accession G7XW26    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
123-144GETTPKPRGKPGPKKKPRLDDGBasic
NLS Segment(s)
PositionSequence
104-140RRKGVPGPKPGTKRGLNQTGETTPKPRGKPGPKKKPR
Subcellular Location(s) mito 18, nucl 7.5, cyto_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013175  INO80_su_Ies4  
Gene Ontology GO:0031011  C:Ino80 complex  
GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF08193  INO80_Ies4  
Amino Acid Sequences MPAASSASSTANGRSSRSGPSKRIVVLKLSTDLLSQFVTPPPEGKDKKSKRGSVSNTDSPVKIQEPSSPASSSAELPLPPSSVDNASDAASTPAAGTPAADTPRRKGVPGPKPGTKRGLNQTGETTPKPRGKPGPKKKPRLDDGTVDTAKLVAAHKLGPKANLGAINAGLRALDRTGAPCRRWERKPLQLKSFTGIQWMLPSWRTPRPLKSEENDEAQGMALETGDSDSKANQSASGVPSEKSTGDGELTPAPPNLTEASSPAIAMTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.34
4 0.43
5 0.48
6 0.46
7 0.51
8 0.54
9 0.54
10 0.59
11 0.52
12 0.48
13 0.45
14 0.43
15 0.4
16 0.36
17 0.32
18 0.25
19 0.23
20 0.19
21 0.16
22 0.13
23 0.12
24 0.14
25 0.16
26 0.16
27 0.18
28 0.2
29 0.3
30 0.32
31 0.37
32 0.45
33 0.51
34 0.61
35 0.68
36 0.71
37 0.68
38 0.76
39 0.76
40 0.75
41 0.75
42 0.71
43 0.67
44 0.62
45 0.55
46 0.45
47 0.41
48 0.33
49 0.26
50 0.2
51 0.2
52 0.21
53 0.24
54 0.26
55 0.23
56 0.22
57 0.22
58 0.23
59 0.19
60 0.17
61 0.17
62 0.14
63 0.15
64 0.15
65 0.13
66 0.12
67 0.12
68 0.12
69 0.11
70 0.12
71 0.11
72 0.12
73 0.11
74 0.11
75 0.11
76 0.1
77 0.08
78 0.08
79 0.07
80 0.06
81 0.06
82 0.06
83 0.05
84 0.06
85 0.08
86 0.11
87 0.14
88 0.15
89 0.17
90 0.26
91 0.27
92 0.26
93 0.29
94 0.37
95 0.42
96 0.51
97 0.54
98 0.53
99 0.56
100 0.59
101 0.6
102 0.53
103 0.5
104 0.48
105 0.51
106 0.46
107 0.43
108 0.43
109 0.39
110 0.38
111 0.33
112 0.28
113 0.25
114 0.29
115 0.29
116 0.3
117 0.37
118 0.44
119 0.55
120 0.64
121 0.69
122 0.73
123 0.82
124 0.85
125 0.84
126 0.79
127 0.76
128 0.68
129 0.61
130 0.56
131 0.54
132 0.47
133 0.38
134 0.32
135 0.24
136 0.21
137 0.17
138 0.12
139 0.06
140 0.06
141 0.09
142 0.11
143 0.15
144 0.16
145 0.16
146 0.16
147 0.16
148 0.17
149 0.17
150 0.15
151 0.12
152 0.12
153 0.11
154 0.1
155 0.09
156 0.07
157 0.05
158 0.06
159 0.05
160 0.05
161 0.05
162 0.08
163 0.16
164 0.21
165 0.22
166 0.28
167 0.35
168 0.42
169 0.46
170 0.52
171 0.54
172 0.59
173 0.69
174 0.69
175 0.71
176 0.7
177 0.68
178 0.62
179 0.58
180 0.47
181 0.4
182 0.33
183 0.24
184 0.19
185 0.19
186 0.17
187 0.14
188 0.17
189 0.18
190 0.23
191 0.28
192 0.31
193 0.38
194 0.45
195 0.5
196 0.54
197 0.54
198 0.57
199 0.55
200 0.56
201 0.49
202 0.41
203 0.35
204 0.28
205 0.24
206 0.15
207 0.11
208 0.06
209 0.05
210 0.05
211 0.06
212 0.06
213 0.06
214 0.07
215 0.08
216 0.09
217 0.12
218 0.12
219 0.12
220 0.13
221 0.17
222 0.18
223 0.22
224 0.22
225 0.2
226 0.22
227 0.23
228 0.22
229 0.2
230 0.19
231 0.15
232 0.16
233 0.16
234 0.17
235 0.19
236 0.21
237 0.2
238 0.2
239 0.19
240 0.17
241 0.19
242 0.18
243 0.16
244 0.15
245 0.15
246 0.18
247 0.18
248 0.18