Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A428TGN0

Protein Details
Accession A0A428TGN0    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
15-40WTGVTSAKERRKRQNRLHQRAYRESRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 12.5, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MPPKLSEVWDPVDDWTGVTSAKERRKRQNRLHQRAYRESRPVSNGLGRSMLTCGTERQTETPESIFFQRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.15
3 0.11
4 0.1
5 0.1
6 0.13
7 0.18
8 0.27
9 0.36
10 0.42
11 0.53
12 0.63
13 0.73
14 0.8
15 0.83
16 0.86
17 0.87
18 0.91
19 0.85
20 0.82
21 0.81
22 0.77
23 0.7
24 0.64
25 0.56
26 0.48
27 0.46
28 0.41
29 0.33
30 0.31
31 0.27
32 0.23
33 0.23
34 0.2
35 0.17
36 0.16
37 0.15
38 0.12
39 0.11
40 0.12
41 0.14
42 0.17
43 0.18
44 0.19
45 0.22
46 0.23
47 0.24
48 0.24
49 0.23
50 0.24