Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428TD09

Protein Details
Accession A0A428TD09    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MPISKKDRRNKEHKKADAAGTBasic
NLS Segment(s)
PositionSequence
5-34KKDRRNKEHKKADAAGTRAPVKRNGLPVKP
Subcellular Location(s) nucl 23.5, cyto_nucl 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR026939  ZNF706/At2g23090_sf  
Amino Acid Sequences MPISKKDRRNKEHKKADAAGTRAPVKRNGLPVKPPKPTSICQNCRKEIVNTNKLQLEVHAETHDQKLWPKEKCWPNDFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.8
3 0.79
4 0.75
5 0.67
6 0.59
7 0.52
8 0.51
9 0.45
10 0.42
11 0.37
12 0.35
13 0.35
14 0.41
15 0.42
16 0.4
17 0.46
18 0.54
19 0.57
20 0.58
21 0.56
22 0.51
23 0.5
24 0.48
25 0.49
26 0.5
27 0.52
28 0.56
29 0.6
30 0.57
31 0.56
32 0.56
33 0.5
34 0.48
35 0.5
36 0.49
37 0.44
38 0.46
39 0.44
40 0.42
41 0.38
42 0.3
43 0.27
44 0.2
45 0.2
46 0.19
47 0.18
48 0.2
49 0.22
50 0.24
51 0.18
52 0.21
53 0.28
54 0.34
55 0.38
56 0.39
57 0.47
58 0.53
59 0.6