Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A428SZ37

Protein Details
Accession A0A428SZ37    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
54-82SPIPIHPPTRRPPRKPRFRAREWRGRAVLBasic
NLS Segment(s)
PositionSequence
61-79PTRRPPRKPRFRAREWRGR
Subcellular Location(s) nucl 16, cyto_nucl 12, cyto 6, mito 4
Family & Domain DBs
Amino Acid Sequences MLASLTVPTTRDVHHHGANAASASAPASQDPATSSGRRTRLRLCASGIRVPLVSPIPIHPPTRRPPRKPRFRAREWRGRAVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.3
3 0.29
4 0.28
5 0.28
6 0.24
7 0.18
8 0.12
9 0.09
10 0.08
11 0.08
12 0.07
13 0.06
14 0.08
15 0.07
16 0.08
17 0.09
18 0.11
19 0.14
20 0.14
21 0.16
22 0.21
23 0.28
24 0.3
25 0.32
26 0.33
27 0.39
28 0.42
29 0.42
30 0.39
31 0.38
32 0.39
33 0.4
34 0.35
35 0.27
36 0.23
37 0.21
38 0.2
39 0.15
40 0.12
41 0.1
42 0.11
43 0.16
44 0.19
45 0.23
46 0.23
47 0.29
48 0.38
49 0.49
50 0.58
51 0.61
52 0.69
53 0.77
54 0.86
55 0.9
56 0.92
57 0.9
58 0.91
59 0.93
60 0.91
61 0.91
62 0.88