Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428T664

Protein Details
Accession A0A428T664    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
22-46LACVLCQQRKKKCDRKSPCSFCIKAHydrophilic
48-73VTCIPSTPAPKRKRRKPTKELLERLEHydrophilic
NLS Segment(s)
PositionSequence
57-66PKRKRRKPTK
Subcellular Location(s) nucl 22, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MAALPTEQQQQSQRPTESKRILACVLCQQRKKKCDRKSPCSFCIKAKVTCIPSTPAPKRKRRKPTKELLERLERCEQLLKRCTCVQKSQMYDMPGHYSESNSSSPTDSHSSPPPEYEKGDGDTFEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.53
3 0.59
4 0.59
5 0.58
6 0.54
7 0.51
8 0.5
9 0.45
10 0.41
11 0.41
12 0.45
13 0.46
14 0.5
15 0.54
16 0.6
17 0.67
18 0.75
19 0.75
20 0.75
21 0.79
22 0.83
23 0.84
24 0.87
25 0.87
26 0.83
27 0.82
28 0.74
29 0.67
30 0.66
31 0.61
32 0.52
33 0.47
34 0.46
35 0.41
36 0.4
37 0.38
38 0.31
39 0.3
40 0.37
41 0.4
42 0.43
43 0.48
44 0.57
45 0.65
46 0.72
47 0.79
48 0.82
49 0.85
50 0.85
51 0.87
52 0.88
53 0.88
54 0.84
55 0.78
56 0.78
57 0.68
58 0.64
59 0.58
60 0.47
61 0.38
62 0.39
63 0.36
64 0.33
65 0.4
66 0.37
67 0.35
68 0.41
69 0.45
70 0.42
71 0.46
72 0.45
73 0.44
74 0.46
75 0.48
76 0.47
77 0.43
78 0.41
79 0.36
80 0.35
81 0.28
82 0.26
83 0.21
84 0.18
85 0.18
86 0.21
87 0.2
88 0.16
89 0.17
90 0.16
91 0.16
92 0.19
93 0.23
94 0.21
95 0.23
96 0.29
97 0.34
98 0.34
99 0.38
100 0.38
101 0.37
102 0.38
103 0.38
104 0.34
105 0.33
106 0.34