Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428TBK0

Protein Details
Accession A0A428TBK0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
49-74YATMKPEQRKAKQDKKDKKAAAKAAAHydrophilic
NLS Segment(s)
PositionSequence
56-77QRKAKQDKKDKKAAAKAAARKK
Subcellular Location(s) cyto 10.5, cyto_nucl 6.5, mito 6, plas 2, extr 2, E.R. 2, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGQFDWFSSIGATDEAVTVLNDQPILFTILLVVLVAVILQCVLIWYIHYATMKPEQRKAKQDKKDKKAAAKAAARKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.07
4 0.07
5 0.07
6 0.08
7 0.08
8 0.08
9 0.07
10 0.07
11 0.08
12 0.1
13 0.08
14 0.07
15 0.07
16 0.06
17 0.06
18 0.06
19 0.05
20 0.02
21 0.02
22 0.02
23 0.02
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.02
30 0.03
31 0.03
32 0.04
33 0.05
34 0.07
35 0.08
36 0.08
37 0.11
38 0.19
39 0.26
40 0.28
41 0.35
42 0.42
43 0.49
44 0.59
45 0.67
46 0.68
47 0.72
48 0.8
49 0.83
50 0.83
51 0.87
52 0.84
53 0.84
54 0.83
55 0.81
56 0.8
57 0.78