Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428SEZ4

Protein Details
Accession A0A428SEZ4    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
173-202SRHLLRLTPTSRKKPGKKRKGATRRSLTLFHydrophilic
NLS Segment(s)
PositionSequence
183-197SRKKPGKKRKGATRR
Subcellular Location(s) nucl 17, cyto 8
Family & Domain DBs
Amino Acid Sequences MSDNKLQLPEWFLNHNITLKEDLDKLRPKIEVVDAEEAKAIKAQNEAGNYKAEGQPPGPTKSQISPETFSMFRDILASALARDSEGRLDSKQSFVIFETREIAVSIDFLDELVKALAKELGTSLISYGFEDLEDLGLEFDLQTPTDPSESKPDKKKGQEKGFGSFLAWLSTGSRHLLRLTPTSRKKPGKKRKGATRRSLTLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.32
3 0.26
4 0.25
5 0.25
6 0.23
7 0.24
8 0.25
9 0.26
10 0.3
11 0.37
12 0.37
13 0.37
14 0.37
15 0.35
16 0.35
17 0.37
18 0.34
19 0.31
20 0.37
21 0.33
22 0.33
23 0.33
24 0.3
25 0.25
26 0.22
27 0.18
28 0.11
29 0.12
30 0.15
31 0.17
32 0.21
33 0.22
34 0.21
35 0.23
36 0.22
37 0.23
38 0.23
39 0.21
40 0.19
41 0.18
42 0.23
43 0.25
44 0.29
45 0.27
46 0.26
47 0.27
48 0.29
49 0.35
50 0.33
51 0.33
52 0.32
53 0.32
54 0.34
55 0.31
56 0.28
57 0.24
58 0.19
59 0.15
60 0.14
61 0.12
62 0.09
63 0.09
64 0.09
65 0.06
66 0.06
67 0.06
68 0.05
69 0.05
70 0.05
71 0.06
72 0.07
73 0.08
74 0.08
75 0.12
76 0.13
77 0.14
78 0.15
79 0.14
80 0.13
81 0.13
82 0.16
83 0.13
84 0.13
85 0.14
86 0.12
87 0.12
88 0.11
89 0.11
90 0.07
91 0.07
92 0.06
93 0.04
94 0.04
95 0.04
96 0.04
97 0.03
98 0.04
99 0.04
100 0.04
101 0.04
102 0.04
103 0.06
104 0.06
105 0.06
106 0.06
107 0.07
108 0.07
109 0.07
110 0.07
111 0.07
112 0.07
113 0.07
114 0.07
115 0.06
116 0.05
117 0.05
118 0.05
119 0.05
120 0.04
121 0.04
122 0.04
123 0.04
124 0.04
125 0.04
126 0.05
127 0.05
128 0.05
129 0.05
130 0.06
131 0.08
132 0.1
133 0.1
134 0.11
135 0.21
136 0.27
137 0.34
138 0.42
139 0.49
140 0.56
141 0.65
142 0.73
143 0.73
144 0.77
145 0.78
146 0.73
147 0.7
148 0.64
149 0.55
150 0.47
151 0.38
152 0.29
153 0.22
154 0.18
155 0.13
156 0.12
157 0.13
158 0.14
159 0.14
160 0.15
161 0.15
162 0.17
163 0.2
164 0.22
165 0.29
166 0.33
167 0.41
168 0.49
169 0.57
170 0.65
171 0.72
172 0.79
173 0.82
174 0.88
175 0.89
176 0.9
177 0.92
178 0.93
179 0.94
180 0.94
181 0.94
182 0.92