Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428UG69

Protein Details
Accession A0A428UG69    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
51-76VAIYFTCKKRAKQRKTKKTGVATAPEHydrophilic
NLS Segment(s)
PositionSequence
59-68KRAKQRKTKK
Subcellular Location(s) cyto 12, cyto_nucl 9, mito 6, nucl 4, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013836  CD34/Podocalyxin  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF06365  CD34_antigen  
Amino Acid Sequences MDAVFGPFEQPYGVNRTTDTEKESKKPQDPSRAIAIVLLVILGLFLAALLVAIYFTCKKRAKQRKTKKTGVATAPEIA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.22
4 0.26
5 0.26
6 0.29
7 0.3
8 0.32
9 0.36
10 0.44
11 0.47
12 0.49
13 0.56
14 0.58
15 0.62
16 0.61
17 0.59
18 0.57
19 0.5
20 0.44
21 0.35
22 0.27
23 0.16
24 0.13
25 0.1
26 0.03
27 0.02
28 0.02
29 0.02
30 0.02
31 0.01
32 0.01
33 0.01
34 0.01
35 0.01
36 0.01
37 0.02
38 0.02
39 0.02
40 0.04
41 0.07
42 0.08
43 0.16
44 0.21
45 0.27
46 0.38
47 0.5
48 0.59
49 0.68
50 0.79
51 0.82
52 0.88
53 0.92
54 0.9
55 0.89
56 0.87
57 0.83
58 0.78