Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428SRB1

Protein Details
Accession A0A428SRB1    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
70-89TSTRLTCSPSRRRGHRPMKKHydrophilic
NLS Segment(s)
PositionSequence
80-89RRRGHRPMKK
Subcellular Location(s) mito 11, nucl 8, cyto_mito 8
Family & Domain DBs
Amino Acid Sequences MAAAHLPPRPLYREGGAASLLSSHRCFELRFSKLWPWVLPPPAPRVITKTLTTLSDAFRLVPCGFVFSVTSTRLTCSPSRRRGHRPMKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.28
3 0.25
4 0.21
5 0.18
6 0.17
7 0.15
8 0.13
9 0.12
10 0.11
11 0.12
12 0.13
13 0.13
14 0.17
15 0.25
16 0.25
17 0.26
18 0.3
19 0.33
20 0.36
21 0.38
22 0.32
23 0.28
24 0.3
25 0.31
26 0.3
27 0.27
28 0.27
29 0.29
30 0.3
31 0.25
32 0.26
33 0.27
34 0.27
35 0.26
36 0.24
37 0.21
38 0.21
39 0.22
40 0.19
41 0.16
42 0.16
43 0.15
44 0.14
45 0.13
46 0.15
47 0.14
48 0.14
49 0.13
50 0.13
51 0.13
52 0.13
53 0.13
54 0.12
55 0.16
56 0.15
57 0.17
58 0.15
59 0.17
60 0.17
61 0.21
62 0.24
63 0.31
64 0.4
65 0.48
66 0.57
67 0.63
68 0.72
69 0.79