Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A421JBQ4

Protein Details
Accession A0A421JBQ4   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
4-29VDLSKYLGSGKKKKKQKTADNVVITEHydrophilic
NLS Segment(s)
PositionSequence
14-18KKKKK
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR018609  Bud13  
Gene Ontology GO:0005681  C:spliceosomal complex  
Pfam View protein in Pfam  
PF09736  Bud13  
Amino Acid Sequences MAKVDLSKYLGSGKKKKKQKTADNVVITEQPLLPTSNEVDDINEDGELAPVQISEPKKESKGFRRIDTGGIVQPQENQDTVYRDSSGRIIDIDEKRAEIERQKGEESERKEQLEKQINQGDVQRIQNEELNESIRRAQSNHLSRNDSEYNDYMKSKAHFDDPISTFVATTNTNPASKTGRPIYTKGVSPPNRFNIPAGAHWDGIDRSNGFEELVMRRRNEINAEKQNKKIHDGIDLELELD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.69
3 0.78
4 0.81
5 0.86
6 0.88
7 0.88
8 0.89
9 0.89
10 0.85
11 0.77
12 0.69
13 0.6
14 0.5
15 0.4
16 0.3
17 0.2
18 0.16
19 0.16
20 0.14
21 0.13
22 0.14
23 0.14
24 0.15
25 0.14
26 0.14
27 0.14
28 0.15
29 0.13
30 0.11
31 0.1
32 0.09
33 0.09
34 0.08
35 0.06
36 0.05
37 0.04
38 0.05
39 0.1
40 0.12
41 0.14
42 0.18
43 0.21
44 0.24
45 0.29
46 0.37
47 0.42
48 0.51
49 0.52
50 0.52
51 0.55
52 0.54
53 0.51
54 0.46
55 0.38
56 0.31
57 0.28
58 0.26
59 0.19
60 0.2
61 0.19
62 0.18
63 0.15
64 0.14
65 0.14
66 0.17
67 0.19
68 0.17
69 0.17
70 0.16
71 0.17
72 0.17
73 0.15
74 0.12
75 0.1
76 0.1
77 0.16
78 0.18
79 0.2
80 0.19
81 0.18
82 0.19
83 0.2
84 0.2
85 0.17
86 0.23
87 0.23
88 0.25
89 0.26
90 0.26
91 0.29
92 0.33
93 0.34
94 0.34
95 0.34
96 0.33
97 0.34
98 0.35
99 0.39
100 0.43
101 0.39
102 0.38
103 0.39
104 0.37
105 0.37
106 0.37
107 0.31
108 0.24
109 0.24
110 0.2
111 0.16
112 0.17
113 0.18
114 0.16
115 0.14
116 0.12
117 0.13
118 0.12
119 0.12
120 0.14
121 0.13
122 0.13
123 0.14
124 0.16
125 0.23
126 0.31
127 0.37
128 0.39
129 0.4
130 0.4
131 0.45
132 0.44
133 0.36
134 0.31
135 0.26
136 0.25
137 0.24
138 0.24
139 0.18
140 0.18
141 0.19
142 0.18
143 0.18
144 0.18
145 0.18
146 0.2
147 0.27
148 0.27
149 0.28
150 0.26
151 0.25
152 0.22
153 0.2
154 0.21
155 0.13
156 0.12
157 0.15
158 0.16
159 0.16
160 0.17
161 0.19
162 0.22
163 0.23
164 0.28
165 0.28
166 0.33
167 0.36
168 0.38
169 0.43
170 0.41
171 0.42
172 0.41
173 0.45
174 0.46
175 0.49
176 0.54
177 0.53
178 0.53
179 0.51
180 0.48
181 0.44
182 0.39
183 0.36
184 0.35
185 0.31
186 0.28
187 0.27
188 0.28
189 0.23
190 0.21
191 0.22
192 0.15
193 0.15
194 0.16
195 0.16
196 0.14
197 0.14
198 0.16
199 0.19
200 0.27
201 0.29
202 0.28
203 0.32
204 0.34
205 0.36
206 0.42
207 0.43
208 0.46
209 0.52
210 0.61
211 0.62
212 0.67
213 0.72
214 0.67
215 0.64
216 0.59
217 0.5
218 0.49
219 0.47
220 0.41
221 0.39