Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A421J375

Protein Details
Accession A0A421J375    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MAEKRKTTRKKKDPDAPKRSLSBasic
NLS Segment(s)
PositionSequence
4-15KRKTTRKKKDPD
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MAEKRKTTRKKKDPDAPKRSLSAYMFFANENRDIIRAENPGIAFGQVGKLLGEKWKAMNADEKVPYETKAEADKKRYEKEKAEYAKRNSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.91
3 0.86
4 0.8
5 0.72
6 0.63
7 0.59
8 0.49
9 0.41
10 0.35
11 0.3
12 0.26
13 0.24
14 0.23
15 0.19
16 0.18
17 0.16
18 0.13
19 0.12
20 0.12
21 0.13
22 0.14
23 0.13
24 0.13
25 0.14
26 0.14
27 0.13
28 0.13
29 0.11
30 0.08
31 0.07
32 0.07
33 0.05
34 0.05
35 0.04
36 0.05
37 0.05
38 0.08
39 0.09
40 0.09
41 0.1
42 0.13
43 0.14
44 0.14
45 0.21
46 0.21
47 0.25
48 0.27
49 0.27
50 0.27
51 0.28
52 0.28
53 0.22
54 0.21
55 0.18
56 0.24
57 0.3
58 0.33
59 0.39
60 0.46
61 0.51
62 0.58
63 0.63
64 0.62
65 0.63
66 0.64
67 0.68
68 0.69
69 0.73
70 0.74