Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A421J4K1

Protein Details
Accession A0A421J4K1   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
87-111DEERREVKKKEENRGKQSKERGQEEBasic
NLS Segment(s)
PositionSequence
92-106EVKKKEENRGKQSKE
Subcellular Location(s) mito 21, cyto_mito 13.333, cyto_nucl 3.666, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004202  COX7C/Cox8  
IPR036636  COX7C/Cox8_sf  
Gene Ontology GO:0005751  C:mitochondrial respiratory chain complex IV  
GO:0006123  P:mitochondrial electron transport, cytochrome c to oxygen  
Pfam View protein in Pfam  
PF02935  COX7C  
Amino Acid Sequences MIGLRLARQRAFQRNFQTSARSFNKIFGAPQEGVYSNLPFKVKNRKIPFAFMWWGVFGFFFAFPFLSTYRSLKKAGSFDIINGVGADEERREVKKKEENRGKQSKERGQEERV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.63
3 0.58
4 0.56
5 0.47
6 0.52
7 0.49
8 0.44
9 0.38
10 0.38
11 0.4
12 0.34
13 0.33
14 0.27
15 0.28
16 0.24
17 0.24
18 0.23
19 0.2
20 0.21
21 0.21
22 0.19
23 0.14
24 0.16
25 0.16
26 0.14
27 0.18
28 0.27
29 0.32
30 0.4
31 0.46
32 0.52
33 0.53
34 0.57
35 0.55
36 0.49
37 0.45
38 0.35
39 0.3
40 0.21
41 0.2
42 0.15
43 0.12
44 0.07
45 0.06
46 0.05
47 0.05
48 0.05
49 0.05
50 0.05
51 0.07
52 0.07
53 0.09
54 0.1
55 0.13
56 0.17
57 0.19
58 0.2
59 0.2
60 0.24
61 0.25
62 0.25
63 0.27
64 0.23
65 0.21
66 0.24
67 0.23
68 0.19
69 0.16
70 0.13
71 0.09
72 0.09
73 0.09
74 0.05
75 0.07
76 0.1
77 0.13
78 0.17
79 0.2
80 0.28
81 0.37
82 0.45
83 0.54
84 0.63
85 0.7
86 0.76
87 0.85
88 0.84
89 0.83
90 0.86
91 0.83
92 0.81
93 0.79