Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A421JD31

Protein Details
Accession A0A421JD31    Localization Confidence Low Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
60-79GEPKIIYKRKFKKDNGPQDAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, cyto 10, cyto_nucl 9.5, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011893  Selenoprotein_Rdx-typ  
IPR036249  Thioredoxin-like_sf  
Pfam View protein in Pfam  
PF10262  Rdx  
Amino Acid Sequences MAKVIIQFCSKCKWHNRAVWYLQEIMQTFGEGDRLVSEISIQPKIDAPGLFQVLVQADEGEPKIIYKRKFKKDNGPQDAPYYYEGFPDSKLLKTLIRDELFPSEKLGHVDGHATLTCEKCEEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.59
3 0.64
4 0.65
5 0.68
6 0.66
7 0.59
8 0.54
9 0.47
10 0.43
11 0.36
12 0.29
13 0.24
14 0.18
15 0.15
16 0.13
17 0.12
18 0.08
19 0.08
20 0.06
21 0.07
22 0.06
23 0.06
24 0.07
25 0.09
26 0.12
27 0.13
28 0.13
29 0.13
30 0.14
31 0.15
32 0.17
33 0.14
34 0.12
35 0.14
36 0.15
37 0.14
38 0.13
39 0.12
40 0.1
41 0.1
42 0.09
43 0.06
44 0.05
45 0.06
46 0.06
47 0.06
48 0.05
49 0.05
50 0.09
51 0.13
52 0.17
53 0.27
54 0.36
55 0.46
56 0.55
57 0.6
58 0.67
59 0.73
60 0.8
61 0.79
62 0.74
63 0.66
64 0.61
65 0.56
66 0.47
67 0.38
68 0.3
69 0.21
70 0.17
71 0.17
72 0.14
73 0.14
74 0.16
75 0.16
76 0.14
77 0.15
78 0.16
79 0.17
80 0.19
81 0.24
82 0.28
83 0.27
84 0.27
85 0.28
86 0.34
87 0.34
88 0.32
89 0.3
90 0.24
91 0.24
92 0.25
93 0.24
94 0.18
95 0.16
96 0.17
97 0.15
98 0.17
99 0.16
100 0.16
101 0.18
102 0.18
103 0.18