Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A421J8K8

Protein Details
Accession A0A421J8K8   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
118-138AEKLKSDAPYRNKNKHKKRRKBasic
NLS Segment(s)
PositionSequence
128-138RNKNKHKKRRK
Subcellular Location(s) nucl 15.5, mito_nucl 13.5, mito 10.5
Family & Domain DBs
Amino Acid Sequences MYKSFPSFSVPWFNRRRSAHDKPLRAEDVPTSFTMPAQKQDGAGVKLLNVSMNDSEDAFVDISCRQLSYAEAAQMGVERPGTIAVLPEAKTGPAASKGPRKVRSEHDEPDLGQSVVFAEKLKSDAPYRNKNKHKKRRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.57
3 0.62
4 0.6
5 0.68
6 0.69
7 0.71
8 0.74
9 0.69
10 0.74
11 0.68
12 0.59
13 0.51
14 0.44
15 0.39
16 0.33
17 0.3
18 0.24
19 0.2
20 0.2
21 0.25
22 0.21
23 0.21
24 0.22
25 0.22
26 0.2
27 0.23
28 0.26
29 0.22
30 0.22
31 0.18
32 0.15
33 0.15
34 0.15
35 0.12
36 0.08
37 0.09
38 0.08
39 0.09
40 0.09
41 0.08
42 0.09
43 0.08
44 0.09
45 0.07
46 0.06
47 0.06
48 0.06
49 0.07
50 0.07
51 0.07
52 0.06
53 0.06
54 0.07
55 0.09
56 0.09
57 0.09
58 0.09
59 0.09
60 0.08
61 0.09
62 0.08
63 0.06
64 0.05
65 0.04
66 0.04
67 0.04
68 0.05
69 0.04
70 0.04
71 0.05
72 0.07
73 0.08
74 0.09
75 0.09
76 0.09
77 0.09
78 0.09
79 0.09
80 0.1
81 0.12
82 0.16
83 0.24
84 0.32
85 0.4
86 0.47
87 0.49
88 0.51
89 0.58
90 0.61
91 0.6
92 0.57
93 0.54
94 0.49
95 0.46
96 0.46
97 0.39
98 0.31
99 0.23
100 0.19
101 0.15
102 0.14
103 0.13
104 0.09
105 0.07
106 0.08
107 0.11
108 0.12
109 0.14
110 0.18
111 0.26
112 0.35
113 0.45
114 0.54
115 0.62
116 0.72
117 0.8
118 0.87