Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A421JF22

Protein Details
Accession A0A421JF22    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
55-80ANERIRRTRERQKEYEKRRRAREEEVBasic
NLS Segment(s)
PositionSequence
60-76RRTRERQKEYEKRRRAR
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013892  Cyt_c_biogenesis_Cmc1-like  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
Pfam View protein in Pfam  
PF08583  Cmc1  
Amino Acid Sequences MHPQLDRVRFDTCESLMDALEECHRQEFLKQALGSCNFEKDELSKCIHHTRLHDANERIRRTRERQKEYEKRRRAREEEVYGKNNYLKKMIEQEAAKKTEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.22
3 0.18
4 0.17
5 0.14
6 0.11
7 0.13
8 0.12
9 0.12
10 0.12
11 0.12
12 0.12
13 0.13
14 0.18
15 0.18
16 0.24
17 0.23
18 0.24
19 0.28
20 0.31
21 0.33
22 0.27
23 0.27
24 0.2
25 0.2
26 0.19
27 0.16
28 0.18
29 0.17
30 0.19
31 0.18
32 0.2
33 0.25
34 0.29
35 0.29
36 0.27
37 0.32
38 0.36
39 0.39
40 0.42
41 0.4
42 0.44
43 0.49
44 0.49
45 0.45
46 0.42
47 0.44
48 0.46
49 0.54
50 0.57
51 0.57
52 0.63
53 0.72
54 0.78
55 0.83
56 0.86
57 0.86
58 0.84
59 0.86
60 0.86
61 0.81
62 0.79
63 0.78
64 0.76
65 0.75
66 0.74
67 0.68
68 0.6
69 0.57
70 0.53
71 0.47
72 0.39
73 0.33
74 0.28
75 0.28
76 0.35
77 0.37
78 0.39
79 0.39
80 0.46
81 0.5