Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A421J9X7

Protein Details
Accession A0A421J9X7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
15-40AAMAGGKKGKKKWNKGKVKDKAQHVIHydrophilic
NLS Segment(s)
PositionSequence
12-35KAAAAMAGGKKGKKKWNKGKVKDK
Subcellular Location(s) cyto 21.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPKIQQTKAAKAAAAMAGGKKGKKKWNKGKVKDKAQHVITLDQEKYDRIMKEVPGFKFVSVSVLVDRLKIGGSMARVALKHLEAEGIIVPVLKHSKQAIYTRAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.26
3 0.2
4 0.13
5 0.16
6 0.19
7 0.21
8 0.23
9 0.29
10 0.37
11 0.46
12 0.57
13 0.63
14 0.72
15 0.8
16 0.85
17 0.9
18 0.9
19 0.91
20 0.87
21 0.83
22 0.8
23 0.7
24 0.64
25 0.55
26 0.47
27 0.39
28 0.37
29 0.3
30 0.23
31 0.22
32 0.18
33 0.18
34 0.19
35 0.16
36 0.13
37 0.15
38 0.16
39 0.22
40 0.27
41 0.26
42 0.25
43 0.25
44 0.23
45 0.22
46 0.21
47 0.17
48 0.11
49 0.12
50 0.08
51 0.11
52 0.11
53 0.1
54 0.1
55 0.09
56 0.08
57 0.08
58 0.08
59 0.07
60 0.08
61 0.08
62 0.09
63 0.11
64 0.11
65 0.12
66 0.14
67 0.12
68 0.12
69 0.11
70 0.11
71 0.08
72 0.1
73 0.09
74 0.08
75 0.07
76 0.07
77 0.07
78 0.1
79 0.14
80 0.13
81 0.16
82 0.18
83 0.22
84 0.28
85 0.35