Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A421J943

Protein Details
Accession A0A421J943    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
140-169KNGGAHGKAKKQKGKRKASSSRKSNKKQKKBasic
NLS Segment(s)
PositionSequence
142-169GGAHGKAKKQKGKRKASSSRKSNKKQKK
Subcellular Location(s) nucl 19, cyto_nucl 12.5, cyto 4, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR019324  MPP6  
Pfam View protein in Pfam  
PF10175  MPP6  
Amino Acid Sequences MSGLSSRVKSMKFMQQVGPDGSKDIEDSSQKKVSLSSEWALPHAAKVLERSRQKQQVDTIGYGSISAFESEDEAAVPQGRKVWGKPDESIRQIDIGRIKDSIIDEKAEKAGKSEKSGQGAEDEGDDGDEDAGDNSGDNAKNGGAHGKAKKQKGKRKASSSRKSNKKQKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.46
3 0.5
4 0.5
5 0.47
6 0.38
7 0.33
8 0.3
9 0.25
10 0.19
11 0.16
12 0.16
13 0.2
14 0.22
15 0.26
16 0.3
17 0.3
18 0.3
19 0.3
20 0.29
21 0.27
22 0.29
23 0.24
24 0.24
25 0.24
26 0.24
27 0.24
28 0.21
29 0.18
30 0.16
31 0.15
32 0.11
33 0.16
34 0.2
35 0.26
36 0.32
37 0.36
38 0.42
39 0.49
40 0.5
41 0.49
42 0.49
43 0.49
44 0.47
45 0.44
46 0.36
47 0.28
48 0.26
49 0.22
50 0.18
51 0.1
52 0.07
53 0.06
54 0.05
55 0.05
56 0.06
57 0.05
58 0.06
59 0.05
60 0.04
61 0.05
62 0.06
63 0.06
64 0.06
65 0.08
66 0.09
67 0.1
68 0.11
69 0.18
70 0.21
71 0.23
72 0.25
73 0.3
74 0.34
75 0.35
76 0.36
77 0.29
78 0.26
79 0.24
80 0.25
81 0.22
82 0.19
83 0.18
84 0.16
85 0.16
86 0.15
87 0.16
88 0.17
89 0.14
90 0.14
91 0.13
92 0.14
93 0.17
94 0.17
95 0.16
96 0.15
97 0.2
98 0.21
99 0.25
100 0.31
101 0.32
102 0.34
103 0.35
104 0.33
105 0.28
106 0.27
107 0.22
108 0.16
109 0.13
110 0.08
111 0.08
112 0.07
113 0.06
114 0.05
115 0.05
116 0.04
117 0.04
118 0.04
119 0.04
120 0.04
121 0.05
122 0.09
123 0.09
124 0.09
125 0.1
126 0.1
127 0.11
128 0.12
129 0.15
130 0.13
131 0.2
132 0.25
133 0.34
134 0.41
135 0.5
136 0.58
137 0.65
138 0.73
139 0.77
140 0.83
141 0.84
142 0.87
143 0.89
144 0.91
145 0.92
146 0.92
147 0.92
148 0.92
149 0.93