Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A421JGM0

Protein Details
Accession A0A421JGM0   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
58-78NAWTLYQRKKQQRQHEQLQKQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR019192  Ribosomal_L28/L40_mit  
IPR042831  YmL28  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09812  MRP-L28  
Amino Acid Sequences MKPFNPVAVFVRGKRTGPVSPSTQKVVNQLSALSASRKQPRLLKLCDEDLIKHKTIMNAWTLYQRKKQQRQHEQLQKQYDSIQEAMEELKAISPRHYHWANKVEEKRFPLEMRVPTDYPADKPWVYNYKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.39
3 0.35
4 0.35
5 0.38
6 0.37
7 0.4
8 0.42
9 0.43
10 0.41
11 0.38
12 0.41
13 0.4
14 0.34
15 0.29
16 0.26
17 0.23
18 0.22
19 0.21
20 0.17
21 0.16
22 0.2
23 0.27
24 0.3
25 0.33
26 0.37
27 0.45
28 0.5
29 0.51
30 0.51
31 0.47
32 0.47
33 0.46
34 0.4
35 0.34
36 0.32
37 0.32
38 0.26
39 0.23
40 0.22
41 0.21
42 0.21
43 0.21
44 0.18
45 0.15
46 0.15
47 0.21
48 0.24
49 0.25
50 0.3
51 0.37
52 0.44
53 0.52
54 0.6
55 0.63
56 0.71
57 0.76
58 0.8
59 0.82
60 0.79
61 0.77
62 0.75
63 0.65
64 0.54
65 0.48
66 0.39
67 0.31
68 0.25
69 0.18
70 0.12
71 0.12
72 0.11
73 0.1
74 0.08
75 0.06
76 0.07
77 0.1
78 0.1
79 0.12
80 0.14
81 0.16
82 0.23
83 0.28
84 0.28
85 0.33
86 0.41
87 0.44
88 0.52
89 0.58
90 0.55
91 0.56
92 0.58
93 0.54
94 0.5
95 0.46
96 0.43
97 0.42
98 0.43
99 0.44
100 0.46
101 0.42
102 0.39
103 0.44
104 0.39
105 0.35
106 0.33
107 0.32
108 0.27
109 0.28
110 0.35