Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A421J4D7

Protein Details
Accession A0A421J4D7   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
164-187KKAVSVRKHLERNRKDKDSKFRLIBasic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto 6, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002108  ADF-H  
IPR029006  ADF-H/Gelsolin-like_dom_sf  
IPR011171  GMF  
IPR012606  Ribosomal_S13/S15_N  
IPR000589  Ribosomal_S15  
IPR023029  Ribosomal_S15P  
IPR009068  S15_NS1_RNA-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003779  F:actin binding  
GO:0071933  F:Arp2/3 complex binding  
GO:0003735  F:structural constituent of ribosome  
GO:0071846  P:actin filament debranching  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00241  Cofilin_ADF  
PF08069  Ribosomal_S13_N  
PF00312  Ribosomal_S15  
PROSITE View protein in PROSITE  
PS51263  ADF_H  
PS00362  RIBOSOMAL_S15  
CDD cd11283  ADF_GMF-beta_like  
cd00353  Ribosomal_S15p_S13e  
Amino Acid Sequences MQAVIYVIDKQSYEIKKDSEQVYTSIEELAEDLPDNTPRYIVVSYPLKTTDGRLKTPLVLVYWRPRTSGQESRMLYAGAVEMMRDKAGVSQNAPAWFKLSADDVVEQVIKYARKGLTPSQIGVILRDAHGVSQSKIVTGNKILRILKSNGLAPEIPEDLYYLIKKAVSVRKHLERNRKDKDSKFRLILIESRIHRLARYYRTVAVLPPNWKYESATASALVN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.32
3 0.34
4 0.41
5 0.41
6 0.38
7 0.36
8 0.33
9 0.33
10 0.3
11 0.27
12 0.21
13 0.19
14 0.13
15 0.13
16 0.11
17 0.08
18 0.08
19 0.08
20 0.09
21 0.12
22 0.14
23 0.13
24 0.13
25 0.12
26 0.15
27 0.15
28 0.14
29 0.17
30 0.22
31 0.22
32 0.24
33 0.25
34 0.24
35 0.24
36 0.27
37 0.3
38 0.28
39 0.3
40 0.31
41 0.31
42 0.31
43 0.33
44 0.3
45 0.23
46 0.21
47 0.22
48 0.28
49 0.34
50 0.34
51 0.33
52 0.33
53 0.37
54 0.42
55 0.46
56 0.41
57 0.42
58 0.42
59 0.42
60 0.41
61 0.35
62 0.27
63 0.19
64 0.15
65 0.08
66 0.07
67 0.05
68 0.05
69 0.06
70 0.06
71 0.05
72 0.05
73 0.08
74 0.12
75 0.13
76 0.13
77 0.16
78 0.18
79 0.22
80 0.23
81 0.19
82 0.17
83 0.16
84 0.15
85 0.13
86 0.12
87 0.09
88 0.09
89 0.1
90 0.08
91 0.09
92 0.09
93 0.08
94 0.07
95 0.09
96 0.08
97 0.08
98 0.12
99 0.12
100 0.13
101 0.15
102 0.18
103 0.23
104 0.24
105 0.24
106 0.21
107 0.23
108 0.21
109 0.2
110 0.18
111 0.11
112 0.1
113 0.1
114 0.09
115 0.07
116 0.1
117 0.11
118 0.1
119 0.13
120 0.13
121 0.12
122 0.15
123 0.16
124 0.15
125 0.18
126 0.22
127 0.2
128 0.26
129 0.26
130 0.25
131 0.29
132 0.3
133 0.29
134 0.26
135 0.27
136 0.22
137 0.24
138 0.22
139 0.18
140 0.18
141 0.16
142 0.14
143 0.11
144 0.11
145 0.1
146 0.12
147 0.11
148 0.09
149 0.09
150 0.09
151 0.1
152 0.16
153 0.23
154 0.25
155 0.31
156 0.38
157 0.46
158 0.56
159 0.63
160 0.67
161 0.69
162 0.76
163 0.79
164 0.81
165 0.8
166 0.8
167 0.83
168 0.81
169 0.79
170 0.72
171 0.67
172 0.6
173 0.55
174 0.51
175 0.45
176 0.43
177 0.37
178 0.39
179 0.38
180 0.36
181 0.33
182 0.34
183 0.37
184 0.37
185 0.43
186 0.41
187 0.41
188 0.44
189 0.44
190 0.41
191 0.42
192 0.41
193 0.39
194 0.39
195 0.4
196 0.39
197 0.39
198 0.38
199 0.34
200 0.32
201 0.3
202 0.28