Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A421JF30

Protein Details
Accession A0A421JF30   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
56-75TNIPAFKKRNSRIRRRYSDFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001683  PX_dom  
IPR036871  PX_dom_sf  
Gene Ontology GO:0035091  F:phosphatidylinositol binding  
Pfam View protein in Pfam  
PF00787  PX  
PROSITE View protein in PROSITE  
PS50195  PX  
Amino Acid Sequences MSHKFQPISDVIDTAPRSKHQYTDIYDEPENFLEVEVRNPQTHTFGRETFTDFEITNIPAFKKRNSRIRRRYSDFVAFRKILEQETSRVVIPPLPGKILLNSNKFSDLNIEKRRAGLEKFLSVVSGHPLIQTGSRALVEFVQNEKWDPKSHVY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.24
4 0.29
5 0.3
6 0.33
7 0.32
8 0.38
9 0.4
10 0.45
11 0.45
12 0.44
13 0.43
14 0.4
15 0.37
16 0.3
17 0.26
18 0.18
19 0.15
20 0.12
21 0.11
22 0.13
23 0.16
24 0.18
25 0.18
26 0.19
27 0.2
28 0.23
29 0.24
30 0.26
31 0.25
32 0.24
33 0.25
34 0.25
35 0.28
36 0.25
37 0.24
38 0.21
39 0.17
40 0.16
41 0.16
42 0.15
43 0.13
44 0.12
45 0.12
46 0.15
47 0.17
48 0.2
49 0.28
50 0.35
51 0.44
52 0.52
53 0.62
54 0.68
55 0.77
56 0.82
57 0.79
58 0.77
59 0.72
60 0.72
61 0.65
62 0.58
63 0.52
64 0.43
65 0.36
66 0.33
67 0.29
68 0.21
69 0.18
70 0.17
71 0.13
72 0.15
73 0.16
74 0.14
75 0.14
76 0.13
77 0.13
78 0.13
79 0.14
80 0.13
81 0.12
82 0.13
83 0.12
84 0.14
85 0.2
86 0.24
87 0.25
88 0.26
89 0.27
90 0.29
91 0.29
92 0.27
93 0.27
94 0.25
95 0.31
96 0.36
97 0.38
98 0.36
99 0.37
100 0.39
101 0.36
102 0.33
103 0.31
104 0.28
105 0.27
106 0.28
107 0.26
108 0.25
109 0.21
110 0.21
111 0.17
112 0.14
113 0.12
114 0.11
115 0.12
116 0.12
117 0.13
118 0.14
119 0.11
120 0.12
121 0.12
122 0.12
123 0.13
124 0.15
125 0.16
126 0.17
127 0.18
128 0.21
129 0.21
130 0.24
131 0.27
132 0.27
133 0.29