Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A421JF28

Protein Details
Accession A0A421JF28   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
272-294WFGFGKKKEQEAKKPPKEKKANVBasic
NLS Segment(s)
PositionSequence
277-291KKKEQEAKKPPKEKK
Subcellular Location(s) cyto 22, nucl 3.5, mito_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR017941  Rieske_2Fe-2S  
IPR036922  Rieske_2Fe-2S_sf  
IPR015879  Ring_hydroxy_dOase_asu_C_dom  
IPR001663  Rng_hydr_dOase-A  
Gene Ontology GO:0051537  F:2 iron, 2 sulfur cluster binding  
GO:0019133  F:choline monooxygenase activity  
GO:0051213  F:dioxygenase activity  
GO:0005506  F:iron ion binding  
GO:0019285  P:glycine betaine biosynthetic process from choline  
Pfam View protein in Pfam  
PF00355  Rieske  
PF00848  Ring_hydroxyl_A  
PROSITE View protein in PROSITE  
PS51296  RIESKE  
CDD cd00680  RHO_alpha_C  
cd03469  Rieske_RO_Alpha_N  
Amino Acid Sequences MAAVTTVKPSAPPAERPQENLLPGEHTLPASWWTSEKIFELEQRAIFNKSWLFCIHESRFKKAGDYFAFSFTGINFFLIKSKVDGKIKAFHNVCRHRAYPVVRKEQGSSVVLGCKYHGWSYNSDGMLTKAPHFEDVQGFKKEENSLFPIKTHVTSHGLVFVNFSASDDEESGYLPFDKFYQGLNSELDEFDFSDYEYHMSYELDGQFNWKTLMDGYQECYHCPTAHPGLNSAFKMETYKVVPKTRYCRHYAEIVRNAEPAAPEPESEESSSWFGFGKKKEQEAKKPPKEKKANVGGEFDGLWVYLFPSNGINCYSPAWYSIRVLPISATHTVLQYDIFTKKGLDEATKKEFVDFLQLVELEDFNLCENTQKNLNKRVYSTGYLHPTKERGVLYYQGLVRDMVKQHYAKEQELGKPINPAFVGQAATDPNVQELDAICDQLECGKSTVEW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.5
3 0.54
4 0.59
5 0.56
6 0.54
7 0.49
8 0.41
9 0.34
10 0.33
11 0.3
12 0.24
13 0.19
14 0.17
15 0.16
16 0.17
17 0.16
18 0.16
19 0.16
20 0.18
21 0.19
22 0.2
23 0.21
24 0.21
25 0.22
26 0.25
27 0.29
28 0.3
29 0.3
30 0.32
31 0.32
32 0.32
33 0.3
34 0.3
35 0.3
36 0.26
37 0.28
38 0.26
39 0.29
40 0.28
41 0.37
42 0.38
43 0.43
44 0.45
45 0.49
46 0.54
47 0.48
48 0.51
49 0.45
50 0.48
51 0.43
52 0.46
53 0.41
54 0.39
55 0.39
56 0.34
57 0.31
58 0.22
59 0.2
60 0.14
61 0.13
62 0.11
63 0.1
64 0.14
65 0.14
66 0.15
67 0.15
68 0.2
69 0.26
70 0.3
71 0.34
72 0.35
73 0.42
74 0.44
75 0.5
76 0.47
77 0.47
78 0.53
79 0.56
80 0.58
81 0.56
82 0.54
83 0.48
84 0.52
85 0.53
86 0.52
87 0.54
88 0.58
89 0.56
90 0.57
91 0.56
92 0.53
93 0.5
94 0.42
95 0.34
96 0.26
97 0.26
98 0.25
99 0.22
100 0.19
101 0.17
102 0.17
103 0.18
104 0.22
105 0.2
106 0.23
107 0.28
108 0.33
109 0.32
110 0.3
111 0.28
112 0.24
113 0.25
114 0.24
115 0.21
116 0.17
117 0.17
118 0.18
119 0.18
120 0.19
121 0.21
122 0.25
123 0.29
124 0.29
125 0.29
126 0.28
127 0.3
128 0.31
129 0.27
130 0.25
131 0.25
132 0.27
133 0.26
134 0.26
135 0.26
136 0.24
137 0.25
138 0.22
139 0.2
140 0.2
141 0.21
142 0.21
143 0.24
144 0.23
145 0.21
146 0.21
147 0.17
148 0.14
149 0.13
150 0.13
151 0.08
152 0.08
153 0.09
154 0.08
155 0.08
156 0.07
157 0.08
158 0.07
159 0.07
160 0.07
161 0.06
162 0.06
163 0.07
164 0.08
165 0.08
166 0.08
167 0.11
168 0.12
169 0.13
170 0.14
171 0.14
172 0.14
173 0.13
174 0.12
175 0.1
176 0.09
177 0.08
178 0.07
179 0.06
180 0.06
181 0.06
182 0.06
183 0.06
184 0.06
185 0.06
186 0.06
187 0.06
188 0.09
189 0.1
190 0.1
191 0.1
192 0.12
193 0.12
194 0.12
195 0.13
196 0.09
197 0.08
198 0.08
199 0.1
200 0.1
201 0.11
202 0.13
203 0.17
204 0.18
205 0.18
206 0.2
207 0.18
208 0.16
209 0.16
210 0.18
211 0.17
212 0.2
213 0.2
214 0.19
215 0.21
216 0.24
217 0.23
218 0.2
219 0.15
220 0.13
221 0.14
222 0.13
223 0.12
224 0.12
225 0.18
226 0.22
227 0.26
228 0.29
229 0.33
230 0.41
231 0.46
232 0.48
233 0.47
234 0.47
235 0.45
236 0.51
237 0.51
238 0.51
239 0.51
240 0.49
241 0.45
242 0.41
243 0.39
244 0.31
245 0.26
246 0.18
247 0.14
248 0.11
249 0.1
250 0.12
251 0.13
252 0.13
253 0.14
254 0.13
255 0.11
256 0.12
257 0.12
258 0.11
259 0.1
260 0.11
261 0.15
262 0.17
263 0.24
264 0.26
265 0.33
266 0.42
267 0.48
268 0.57
269 0.63
270 0.72
271 0.74
272 0.8
273 0.8
274 0.82
275 0.85
276 0.79
277 0.78
278 0.77
279 0.75
280 0.68
281 0.65
282 0.54
283 0.46
284 0.4
285 0.31
286 0.2
287 0.12
288 0.09
289 0.05
290 0.06
291 0.06
292 0.06
293 0.07
294 0.09
295 0.09
296 0.1
297 0.12
298 0.12
299 0.12
300 0.13
301 0.14
302 0.11
303 0.14
304 0.15
305 0.14
306 0.16
307 0.18
308 0.21
309 0.2
310 0.2
311 0.18
312 0.18
313 0.2
314 0.19
315 0.18
316 0.14
317 0.15
318 0.15
319 0.15
320 0.13
321 0.11
322 0.13
323 0.12
324 0.12
325 0.12
326 0.12
327 0.12
328 0.15
329 0.16
330 0.18
331 0.23
332 0.28
333 0.35
334 0.37
335 0.37
336 0.35
337 0.34
338 0.28
339 0.31
340 0.25
341 0.19
342 0.18
343 0.18
344 0.18
345 0.18
346 0.17
347 0.1
348 0.1
349 0.09
350 0.07
351 0.08
352 0.07
353 0.1
354 0.12
355 0.14
356 0.23
357 0.29
358 0.35
359 0.43
360 0.5
361 0.5
362 0.51
363 0.56
364 0.53
365 0.52
366 0.49
367 0.48
368 0.5
369 0.49
370 0.48
371 0.45
372 0.42
373 0.39
374 0.4
375 0.33
376 0.27
377 0.28
378 0.3
379 0.29
380 0.32
381 0.32
382 0.28
383 0.28
384 0.26
385 0.23
386 0.25
387 0.25
388 0.23
389 0.28
390 0.28
391 0.3
392 0.37
393 0.41
394 0.37
395 0.4
396 0.42
397 0.41
398 0.47
399 0.48
400 0.4
401 0.44
402 0.42
403 0.41
404 0.35
405 0.3
406 0.25
407 0.24
408 0.24
409 0.16
410 0.19
411 0.16
412 0.18
413 0.19
414 0.17
415 0.15
416 0.15
417 0.14
418 0.13
419 0.12
420 0.17
421 0.16
422 0.16
423 0.15
424 0.15
425 0.15
426 0.18
427 0.19
428 0.15
429 0.15