Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A421J7X0

Protein Details
Accession A0A421J7X0    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
30-49QEKPKKPKGRAYKRLLYTRRBasic
NLS Segment(s)
PositionSequence
25-43PKVEPQEKPKKPKGRAYKR
Subcellular Location(s) nucl 10, mito 10, mito_nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MDTQQFQLSFHGSLARAGKVKSQTPKVEPQEKPKKPKGRAYKRLLYTRRFVNVTLTNGKRKMNPSPASQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.2
4 0.2
5 0.25
6 0.26
7 0.31
8 0.35
9 0.4
10 0.42
11 0.44
12 0.53
13 0.55
14 0.6
15 0.57
16 0.61
17 0.65
18 0.67
19 0.7
20 0.7
21 0.72
22 0.68
23 0.74
24 0.75
25 0.75
26 0.79
27 0.79
28 0.78
29 0.76
30 0.81
31 0.78
32 0.71
33 0.64
34 0.59
35 0.56
36 0.49
37 0.42
38 0.4
39 0.39
40 0.4
41 0.44
42 0.43
43 0.45
44 0.47
45 0.49
46 0.47
47 0.47
48 0.51
49 0.52