Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A421JGS9

Protein Details
Accession A0A421JGS9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
35-57ATGLKKTKQGRKQQRIGKIKQTQHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 10, mito 9, E.R. 4, plas 3
Family & Domain DBs
Amino Acid Sequences MTKPFSSNGAFFMLAPVFLITSDYVVSRFTGATAATGLKKTKQGRKQQRIGKIKQTQEDESEDG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.11
4 0.07
5 0.07
6 0.08
7 0.05
8 0.06
9 0.06
10 0.06
11 0.06
12 0.07
13 0.07
14 0.06
15 0.06
16 0.06
17 0.06
18 0.06
19 0.06
20 0.06
21 0.07
22 0.07
23 0.09
24 0.1
25 0.11
26 0.18
27 0.25
28 0.33
29 0.41
30 0.51
31 0.61
32 0.71
33 0.79
34 0.8
35 0.83
36 0.84
37 0.82
38 0.82
39 0.79
40 0.76
41 0.74
42 0.72
43 0.65
44 0.59